KEGG   Homo sapiens (human): 7408Help
Entry
7408              CDS       T01001                                 

Gene name
VASP
Definition
vasodilator-stimulated phosphoprotein
Orthology
K06274  
vasodilator-stimulated phosphoprotein
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
Focal adhesion
Platelet activation
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    7408 (VASP)
   04022 cGMP - PKG signaling pathway
    7408 (VASP)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7408 (VASP)
 Organismal Systems
  Immune system
   04611 Platelet activation
    7408 (VASP)
   04666 Fc gamma R-mediated phagocytosis
    7408 (VASP)
   04670 Leukocyte transendothelial migration
    7408 (VASP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7408 (VASP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 380 aa AA seqDB search
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacggtcatctgttccagccgggccactgtgatgctttatgatgatggcaac
aagcgatggctccctgctggcacgggtccccaggccttcagccgcgtccagatctaccac
aaccccacggccaattcctttcgcgtcgtgggccggaagatgcagcccgaccagcaggtg
gtcatcaactgtgccatcgtccggggtgtcaagtataaccaggccacccccaacttccat
cagtggcgcgacgctcgccaggtctggggcctcaacttcggcagcaaggaggatgcggcc
cagtttgccgccggcatggccagtgccctagaggcgttggaaggaggtgggccccctcca
cccccagcacttcccacctggtcggtcccgaacggcccctccccggaggaggtggagcag
cagaaaaggcagcagcccggcccgtcggagcacatagagcgccgggtctccaatgcagga
ggcccacctgctccccccgctgggggtccacccccaccaccaggacctccccctcctcca
ggtccccccccacccccaggtttgcccccttcgggggtcccagctgcagcgcacggagca
gggggaggaccaccccctgcaccccctctcccggcagcacagggccctggtggtggggga
gctggggccccaggcctggccgcagctattgctggagccaaactcaggaaagtcagcaag
caggaggaggcctcaggggggcccacagcccccaaagctgagagtggtcgaagcggaggt
gggggactcatggaagagatgaacgccatgctggcccggagaaggaaagccacgcaagtt
ggggagaaaacccccaaggatgaatctgccaatcaggaggagccagaggccagagtcccg
gcccagagtgaatctgtgcggagaccctgggagaagaacagcacaaccttgccaaggatg
aagtcgtcttcttcggtgaccacttccgagacccaaccctgcacgcccagctccagtgat
tactcggacctacagagggtgaaacaggagcttctggaagaggtgaagaaggaattgcag
aaagtgaaagaggaaatcattgaagccttcgtccaggagctgaggaagcggggttctccc
tga

DBGET integrated database retrieval system