KEGG   Homo sapiens (human): 7408Help
Entry
7408              CDS       T01001                                 

Gene name
VASP
Definition
vasodilator-stimulated phosphoprotein
Orthology
K06274  
vasodilator-stimulated phosphoprotein
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 380 aa AA seqDB search
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacggtcatctgttccagccgggccactgtgatgctttatgatgatggcaac
aagcgatggctccctgctggcacgggtccccaggccttcagccgcgtccagatctaccac
aaccccacggccaattcctttcgcgtcgtgggccggaagatgcagcccgaccagcaggtg
gtcatcaactgtgccatcgtccggggtgtcaagtataaccaggccacccccaacttccat
cagtggcgcgacgctcgccaggtctggggcctcaacttcggcagcaaggaggatgcggcc
cagtttgccgccggcatggccagtgccctagaggcgttggaaggaggtgggccccctcca
cccccagcacttcccacctggtcggtcccgaacggcccctccccggaggaggtggagcag
cagaaaaggcagcagcccggcccgtcggagcacatagagcgccgggtctccaatgcagga
ggcccacctgctccccccgctgggggtccacccccaccaccaggacctccccctcctcca
ggtccccccccacccccaggtttgcccccttcgggggtcccagctgcagcgcacggagca
gggggaggaccaccccctgcaccccctctcccggcagcacagggccctggtggtggggga
gctggggccccaggcctggccgcagctattgctggagccaaactcaggaaagtcagcaag
caggaggaggcctcaggggggcccacagcccccaaagctgagagtggtcgaagcggaggt
gggggactcatggaagagatgaacgccatgctggcccggagaaggaaagccacgcaagtt
ggggagaaaacccccaaggatgaatctgccaatcaggaggagccagaggccagagtcccg
gcccagagtgaatctgtgcggagaccctgggagaagaacagcacaaccttgccaaggatg
aagtcgtcttcttcggtgaccacttccgagacccaaccctgcacgcccagctccagtgat
tactcggacctacagagggtgaaacaggagcttctggaagaggtgaagaaggaattgcag
aaagtgaaagaggaaatcattgaagccttcgtccaggagctgaggaagcggggttctccc
tga

DBGET integrated database retrieval system