KEGG   Homo sapiens (human): 7415Help
Entry
7415              CDS       T01001                                 

Gene name
VCP, ALS14, HEL-220, HEL-S-70, IBMPFD, IBMPFD1, TERA, p97
Definition
valosin containing protein (EC:3.6.4.6)
Orthology
K13525  
transitional endoplasmic reticulum ATPase
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
p97-Ufd1-Npl4 complex
HRD1/SEL1 ERAD complex
Disease
H00078  
Frontotemporal lobar degeneration (FTLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7415 (VCP)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    7415 (VCP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7415 (VCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 806 aa AA seqDB search
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggagccgattcaaaaggtgatgacctatcaacagccattctcaaacagaag
aaccgtcccaatcggttaattgttgatgaagccatcaatgaggacaacagtgtggtgtcc
ttgtcccagcccaagatggatgaattgcagttgttccgaggtgacacagtgttgctgaaa
ggaaagaagagacgagaagctgtttgcatcgtcctttctgatgatacttgttctgatgag
aagattcggatgaatagagttgttcggaataaccttcgtgtacgcctaggggatgtcatc
agcatccagccatgccctgatgtgaagtacggcaaacgtatccatgtgctgcccattgat
gacacagtggaaggcattactggtaatctcttcgaggtataccttaagccgtacttcctg
gaagcgtatcgacccatccggaaaggagacatttttcttgtccgtggtgggatgcgtgct
gtggagttcaaagtggtggaaacagatcctagcccttattgcattgttgctccagacaca
gtgatccactgcgaaggggagcctatcaaacgagaggatgaggaagagtccttgaatgaa
gtagggtatgatgacattggtggctgcaggaagcagctagctcagataaaggagatggtg
gaactgcccctgagacatcctgccctctttaaggcaattggtgtgaagcctcctagagga
atcctgctttacggacctcctggaacaggaaagaccctgattgctcgagctgtagcaaat
gagactggagccttcttcttcttgatcaatggtcctgagatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaggctgagaagaatgctcctgccatc
atcttcattgatgagctagatgccatcgctcccaaaagagagaaaactcatggcgaggtg
gagcggcgcattgtatcacagttgttgaccctcatggatggcctaaagcagagggcacat
gtgattgttatggcagcaaccaacagacccaacagcattgacccagctctacggcgattt
ggtcgctttgacagggaggtagatattggaattcctgatgctacaggacgcttagagatt
cttcagatccataccaagaacatgaagctggcagatgatgtggacctggaacaggtagcc
aatgagactcacgggcatgtgggtgctgacttagcagccctgtgctcagaggctgctctg
caagccatccgcaagaagatggatctcattgacctagaggatgagaccattgatgccgag
gtcatgaactctctagcagttactatggatgacttccggtgggccttgagccagagtaac
ccatcagcactgcgggaaaccgtggtagaggtgccacaggtaacctgggaagacatcggg
ggcctagaggatgtcaaacgtgagctacaggagctggtccagtatcctgtggagcaccca
gacaaattcctgaagtttggcatgacaccttccaagggagttctgttctatggacctcct
ggctgtgggaaaactttgttggccaaagccattgctaatgaatgccaggccaacttcatc
tccatcaagggtcctgagctgctcaccatgtggtttggggagtctgaggccaatgtcaga
gaaatctttgacaaggcccgccaagctgccccctgtgtgctattctttgatgagctggat
tcgattgccaaggctcgtggaggtaacattggagatggtggtggggctgctgaccgagtc
atcaaccagatcctgacagaaatggatggcatgtccacaaaaaaaaatgtgttcatcatt
ggcgctaccaaccggcctgacatcattgatcctgccatcctcagacctggccgtcttgat
cagctcatctacatcccacttcctgatgagaagtcccgtgttgccatcctcaaggctaac
ctgcgcaagtccccagttgccaaggatgtggacttggagttcctggctaaaatgactaat
ggcttctctggagctgacctgacagagatttgccagcgtgcttgcaagctggccatccgt
gaatccatcgagagtgagattaggcgagaacgagagaggcagacaaacccatcagccatg
gaggtagaagaggatgatccagtgcctgagatccgtcgagatcactttgaagaagccatg
cgctttgcgcgccgttctgtcagtgacaatgacattcggaagtatgagatgtttgcccag
acccttcagcagagtcggggctttggcagcttcagattcccttcagggaaccagggtgga
gctggccccagtcagggcagtggaggcggcacaggtggcagtgtatacacagaagacaat
gatgatgacctgtatggctaa

DBGET integrated database retrieval system