KEGG   Homo sapiens (human): 7415Help
Entry
7415              CDS       T01001                                 

Gene name
VCP, CDC48, TERA, p97
Definition
(RefSeq) valosin containing protein
  KO
K13525  
transitional endoplasmic reticulum ATPase
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Legionellosis
Module
p97-Ufd1-Npl4 complex
HRD1/SEL1 ERAD complex
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00078  
Frontotemporal lobar degeneration (FTLD)
H00264  
Charcot-Marie-Tooth disease (CMT)
H02031  
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7415 (VCP)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    7415 (VCP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     7415 (VCP)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    7415 (VCP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7415 (VCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P55072(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 806 aa AA seqDB search
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggagccgattcaaaaggtgatgacctatcaacagccattctcaaacagaag
aaccgtcccaatcggttaattgttgatgaagccatcaatgaggacaacagtgtggtgtcc
ttgtcccagcccaagatggatgaattgcagttgttccgaggtgacacagtgttgctgaaa
ggaaagaagagacgagaagctgtttgcatcgtcctttctgatgatacttgttctgatgag
aagattcggatgaatagagttgttcggaataaccttcgtgtacgcctaggggatgtcatc
agcatccagccatgccctgatgtgaagtacggcaaacgtatccatgtgctgcccattgat
gacacagtggaaggcattactggtaatctcttcgaggtataccttaagccgtacttcctg
gaagcgtatcgacccatccggaaaggagacatttttcttgtccgtggtgggatgcgtgct
gtggagttcaaagtggtggaaacagatcctagcccttattgcattgttgctccagacaca
gtgatccactgcgaaggggagcctatcaaacgagaggatgaggaagagtccttgaatgaa
gtagggtatgatgacattggtggctgcaggaagcagctagctcagataaaggagatggtg
gaactgcccctgagacatcctgccctctttaaggcaattggtgtgaagcctcctagagga
atcctgctttacggacctcctggaacaggaaagaccctgattgctcgagctgtagcaaat
gagactggagccttcttcttcttgatcaatggtcctgagatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaggctgagaagaatgctcctgccatc
atcttcattgatgagctagatgccatcgctcccaaaagagagaaaactcatggcgaggtg
gagcggcgcattgtatcacagttgttgaccctcatggatggcctaaagcagagggcacat
gtgattgttatggcagcaaccaacagacccaacagcattgacccagctctacggcgattt
ggtcgctttgacagggaggtagatattggaattcctgatgctacaggacgcttagagatt
cttcagatccataccaagaacatgaagctggcagatgatgtggacctggaacaggtagcc
aatgagactcacgggcatgtgggtgctgacttagcagccctgtgctcagaggctgctctg
caagccatccgcaagaagatggatctcattgacctagaggatgagaccattgatgccgag
gtcatgaactctctagcagttactatggatgacttccggtgggccttgagccagagtaac
ccatcagcactgcgggaaaccgtggtagaggtgccacaggtaacctgggaagacatcggg
ggcctagaggatgtcaaacgtgagctacaggagctggtccagtatcctgtggagcaccca
gacaaattcctgaagtttggcatgacaccttccaagggagttctgttctatggacctcct
ggctgtgggaaaactttgttggccaaagccattgctaatgaatgccaggccaacttcatc
tccatcaagggtcctgagctgctcaccatgtggtttggggagtctgaggccaatgtcaga
gaaatctttgacaaggcccgccaagctgccccctgtgtgctattctttgatgagctggat
tcgattgccaaggctcgtggaggtaacattggagatggtggtggggctgctgaccgagtc
atcaaccagatcctgacagaaatggatggcatgtccacaaaaaaaaatgtgttcatcatt
ggcgctaccaaccggcctgacatcattgatcctgccatcctcagacctggccgtcttgat
cagctcatctacatcccacttcctgatgagaagtcccgtgttgccatcctcaaggctaac
ctgcgcaagtccccagttgccaaggatgtggacttggagttcctggctaaaatgactaat
ggcttctctggagctgacctgacagagatttgccagcgtgcttgcaagctggccatccgt
gaatccatcgagagtgagattaggcgagaacgagagaggcagacaaacccatcagccatg
gaggtagaagaggatgatccagtgcctgagatccgtcgagatcactttgaagaagccatg
cgctttgcgcgccgttctgtcagtgacaatgacattcggaagtatgagatgtttgcccag
acccttcagcagagtcggggctttggcagcttcagattcccttcagggaaccagggtgga
gctggccccagtcagggcagtggaggcggcacaggtggcagtgtatacacagaagacaat
gatgatgacctgtatggctaa

DBGET integrated database retrieval system