KEGG   Homo sapiens (human): 7417Help
Entry
7417              CDS       T01001                                 

Gene name
VDAC2, POR
Definition
(RefSeq) voltage dependent anion channel 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
hsa05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7417 (VDAC2)
   04022 cGMP - PKG signaling pathway
    7417 (VDAC2)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    7417 (VDAC2)
   04217 Necroptosis
    7417 (VDAC2)
   04218 Cellular senescence
    7417 (VDAC2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7417 (VDAC2)
  Digestive system
   04979 Cholesterol metabolism
    7417 (VDAC2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7417 (VDAC2)
   05016 Huntington's disease
    7417 (VDAC2)
  Infectious diseases
   05166 HTLV-I infection
    7417 (VDAC2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7417 (VDAC2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   7417 (VDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 7417
NCBI-ProteinID: NP_001171752
OMIM: 193245
HGNC: 12672
Ensembl: ENSG00000165637
Vega: OTTHUMG00000018517
Pharos: P45880(Tchem)
UniProt: P45880 A0A024QZT0
Position
10q22.2
AA seq 294 aa AA seqDB search
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK
KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF
AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP
TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccacggacagacttgcgcgcgtccaatgtgtattcctccatcatatgctgac
cttggcaaagctgccagagatattttcaacaaaggatttggttttgggttggtgaaactg
gatgtgaaaacaaagtcttgcagtggcgtggaattttcaacgtccggttcatctaataca
gacactggtaaagttactgggaccttggagaccaaatacaagtggtgtgagtatggtctg
actttcacagaaaagtggaacactgataacactctgggaacagaaatcgcaattgaagac
cagatttgtcaaggtttgaaactgacatttgatactaccttctcaccaaacacaggaaag
aaaagtggtaaaatcaagtcttcttacaagagggagtgtataaaccttggttgtgatgtt
gactttgattttgctggacctgcaatccatggttcagctgtctttggttatgagggctgg
cttgctggctaccagatgacctttgacagtgccaaatcaaagctgacaaggaataacttt
gcagtgggctacaggactggggacttccagctacacactaatgtcaatgatgggacagaa
tttggaggatcaatttatcagaaagtttgtgaagatcttgacacttcagtaaaccttgct
tggacatcaggtaccaactgcactcgttttggcattgcagctaaatatcagttggatccc
actgcttccatttctgcaaaagtcaacaactctagcttaattggagtaggctatactcag
actctgaggcctggtgtgaagcttacactctctgctctggtagatgggaagagcattaat
gctggaggccacaaggttgggctcgccctggagttggaggcttaa

DBGET integrated database retrieval system