KEGG   Homo sapiens (human): 7419Help
Entry
7419              CDS       T01001                                 

Gene name
VDAC3, HD-VDAC3, VDAC-3
Definition
voltage-dependent anion channel 3
Orthology
K15041  
voltage-dependent anion channel protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Parkinson's disease
Huntington's disease
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7419 (VDAC3)
   04022 cGMP - PKG signaling pathway
    7419 (VDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7419 (VDAC3)
  Neurodegenerative diseases
   05012 Parkinson's disease
    7419 (VDAC3)
   05016 Huntington's disease
    7419 (VDAC3)
  Infectious diseases
   05166 HTLV-I infection
    7419 (VDAC3)
   05161 Hepatitis B
    7419 (VDAC3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7419 (VDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2
AA seq 284 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVMEFSTSGHAYTDTGKASGNLE
TKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYK
RDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQ
LHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNN
ASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacgtactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtgatg
gaattttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaa
accaaatataaggtctgtaactatggacttaccttcacccagaaatggaacacagacaat
actctagggacagaaatctcttgggagaataagttggctgaagggttgaaactgactctt
gataccatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaa
cgggattgttttagtgttggcagtaatgttgatatagatttttctggaccaaccatctat
ggctgggctgtgttggccttcgaagggtggcttgctggctatcagatgagttttgacaca
gccaaatccaaactgtcacagaataatttcgccctgggttacaaggctgcggacttccag
ctgcacacacatgtgaacgatggcactgaatttggaggttctatctaccagaaggtgaat
gagaagattgaaacatccataaaccttgcttggacagctgggagtaacaacacccgtttt
ggcattgctgctaagtacatgctggattgtagaacttctctctctgctaaagtaaataat
gccagcctgattggactgggttatactcagacccttcgaccaggagtcaaattgacttta
tcagctttaatcgatgggaagaacttcagtgcaggaggtcacaaggttggcttgggattt
gaactggaagcttaa

DBGET integrated database retrieval system