KEGG   Homo sapiens (human): 7419Help
Entry
7419              CDS       T01001                                 

Gene name
VDAC3, HD-VDAC3, VDAC-3
Definition
voltage-dependent anion channel 3
Orthology
K15041  
voltage-dependent anion channel protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Parkinson's disease
Huntington's disease
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.2
AA seq 284 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVMEFSTSGHAYTDTGKASGNLE
TKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYK
RDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQ
LHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNN
ASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacgtactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtgatg
gaattttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaa
accaaatataaggtctgtaactatggacttaccttcacccagaaatggaacacagacaat
actctagggacagaaatctcttgggagaataagttggctgaagggttgaaactgactctt
gataccatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaa
cgggattgttttagtgttggcagtaatgttgatatagatttttctggaccaaccatctat
ggctgggctgtgttggccttcgaagggtggcttgctggctatcagatgagttttgacaca
gccaaatccaaactgtcacagaataatttcgccctgggttacaaggctgcggacttccag
ctgcacacacatgtgaacgatggcactgaatttggaggttctatctaccagaaggtgaat
gagaagattgaaacatccataaaccttgcttggacagctgggagtaacaacacccgtttt
ggcattgctgctaagtacatgctggattgtagaacttctctctctgctaaagtaaataat
gccagcctgattggactgggttatactcagacccttcgaccaggagtcaaattgacttta
tcagctttaatcgatgggaagaacttcagtgcaggaggtcacaaggttggcttgggattt
gaactggaagcttaa

DBGET integrated database retrieval system