KEGG   Homo sapiens (human): 7419Help
Entry
7419              CDS       T01001                                 

Gene name
VDAC3, HD-VDAC3, VDAC-3
Definition
(RefSeq) voltage dependent anion channel 3
  KO
K15041  
voltage-dependent anion channel protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Ferroptosis
Necroptosis
Cellular senescence
NOD-like receptor signaling pathway
Cholesterol metabolism
Parkinson's disease
Huntington's disease
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Network
N00267  
HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7419 (VDAC3)
   04022 cGMP - PKG signaling pathway
    7419 (VDAC3)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    7419 (VDAC3)
   04217 Necroptosis
    7419 (VDAC3)
   04218 Cellular senescence
    7419 (VDAC3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    7419 (VDAC3)
  Digestive system
   04979 Cholesterol metabolism
    7419 (VDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7419 (VDAC3)
  Neurodegenerative diseases
   05012 Parkinson's disease
    7419 (VDAC3)
   05016 Huntington's disease
    7419 (VDAC3)
  Infectious diseases
   05166 HTLV-I infection
    7419 (VDAC3)
   05161 Hepatitis B
    7419 (VDAC3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7419 (VDAC3)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   7419 (VDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y277(Tbio)
UniProt: 
Position
8p11.21
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKR
DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacgtactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaaacc
aaatataaggtctgtaactatggacttaccttcacccagaaatggaacacagacaatact
ctagggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaacgg
gattgttttagtgttggcagtaatgttgatatagatttttctggaccaaccatctatggc
tgggctgtgttggccttcgaagggtggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtcacagaataatttcgccctgggttacaaggctgcggacttccagctg
cacacacatgtgaacgatggcactgaatttggaggttctatctaccagaaggtgaatgag
aagattgaaacatccataaaccttgcttggacagctgggagtaacaacacccgttttggc
attgctgctaagtacatgctggattgtagaacttctctctctgctaaagtaaataatgcc
agcctgattggactgggttatactcagacccttcgaccaggagtcaaattgactttatca
gctttaatcgatgggaagaacttcagtgcaggaggtcacaaggttggcttgggatttgaa
ctggaagcttaa

DBGET integrated database retrieval system