KEGG   Homo sapiens (human): 7421Help
Entry
7421              CDS       T01001                                 

Gene name
VDR, NR1I1
Definition
vitamin D (1,25- dihydroxyvitamin D3) receptor
Orthology
K08539  
vitamin D3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine and other factor-regulated calcium reabsorption
Mineral absorption
Tuberculosis
Disease
H00342  
Tuberculosis
H00784  
Localized autosomal recessive hypotrichosis
H01143  
Vitamin D-dependent rickets
Drug target
Ergocalciferol: 
Dihydrotachysterol: 
Alfacalcidol: 
Calcitriol: 
Colecalciferol: 
Calcipotriol: 
Tacalcitol: 
Paricalcitol: 
Other: 
Class
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.11
AA seq 427 aa AA seqDB search
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaatggcggccagcacttccctgcctgaccctggagactttgaccggaacgtg
ccccggatctgtggggtgtgtggagaccgagccactggctttcacttcaatgctatgacc
tgtgaaggctgcaaaggcttcttcaggcgaagcatgaagcggaaggcactattcacctgc
cccttcaacggggactgccgcatcaccaaggacaaccgacgccactgccaggcctgccgg
ctcaaacgctgtgtggacatcggcatgatgaaggagttcattctgacagatgaggaagtg
cagaggaagcgggagatgatcctgaagcggaaggaggaggaggccttgaaggacagtctg
cggcccaagctgtctgaggagcagcagcgcatcattgccatactgctggacgcccaccat
aagacctacgaccccacctactccgacttctgccagttccggcctccagttcgtgtgaat
gatggtggagggagccatccttccaggcccaactccagacacactcccagcttctctggg
gactcctcctcctcctgctcagatcactgtatcacctcttcagacatgatggactcgtcc
agcttctccaatctggatctgagtgaagaagattcagatgacccttctgtgaccctagag
ctgtcccagctctccatgctgccccacctggctgacctggtcagttacagcatccaaaag
gtcattggctttgctaagatgataccaggattcagagacctcacctctgaggaccagatc
gtactgctgaagtcaagtgccattgaggtcatcatgttgcgctccaatgagtccttcacc
atggacgacatgtcctggacctgtggcaaccaagactacaagtaccgcgtcagtgacgtg
accaaagccggacacagcctggagctgattgagcccctcatcaagttccaggtgggactg
aagaagctgaacttgcatgaggaggagcatgtcctgctcatggccatctgcatcgtctcc
ccagatcgtcctggggtgcaggacgccgcgctgattgaggccatccaggaccgcctgtcc
aacacactgcagacgtacatccgctgccgccacccgcccccgggcagccacctgctctat
gccaagatgatccagaagctagccgacctgcgcagcctcaatgaggagcactccaagcag
taccgctgcctctccttccagcctgagtgcagcatgaagctaacgccccttgtgctcgaa
gtgtttggcaatgagatctcctga

DBGET integrated database retrieval system