KEGG   Homo sapiens (human): 7423Help
Entry
7423              CDS       T01001                                 

Gene name
VEGFB, VEGFL, VRF
Definition
vascular endothelial growth factor B
Orthology
K16858  
vascular endothelial growth factor B
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Pathways in cancer
Disease
H00018  
Gastric cancer
Drug target
Aflibercept: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 188 aa AA seqDB search
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDT
CRCRKLRR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcactcctgcagctggcccccgcccag
gcccctgtctcccagcctgatgcccctggccaccagaggaaagtggtgtcatggatagat
gtgtatactcgcgctacctgccagccccgggaggtggtggtgcccttgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagccagacagccccaggccc
ctctgcccacgctgcacccagcaccaccagcgccctgacccccggacctgccgctgccgc
tgccgacgccgcagcttcctccgttgccaagggcggggcttagagctcaacccagacacc
tgcaggtgccggaagctgcgaaggtga

DBGET integrated database retrieval system