KEGG   Homo sapiens (human): 7423Help
Entry
7423              CDS       T01001                                 

Gene name
VEGFB, VEGFL, VRF
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  
vascular endothelial growth factor B
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Disease
H00018  
Gastric cancer
Drug target
Aflibercept: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7423 (VEGFB)
   04015 Rap1 signaling pathway
    7423 (VEGFB)
   04151 PI3K-Akt signaling pathway
    7423 (VEGFB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7423 (VEGFB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7423 (VEGFB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7423 (VEGFB)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7423 (VEGFB)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7423 (VEGFB)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   7423 (VEGFB)
  NRP2; neuropilin 2 [KO:K06819]
   7423 (VEGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 207 aa AA seqDB search
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcactcctgcagctggcccccgcccag
gcccctgtctcccagcctgatgcccctggccaccagaggaaagtggtgtcatggatagat
gtgtatactcgcgctacctgccagccccgggaggtggtggtgcccttgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagccagacagggctgccact
ccccaccaccgtccccagccccgttctgttccgggctgggactctgcccccggagcaccc
tccccagctgacatcacccatcccactccagccccaggcccctctgcccacgctgcaccc
agcaccaccagcgccctgacccccggacctgccgctgccgctgccgacgccgcagcttcc
tccgttgccaagggcggggcttag

DBGET integrated database retrieval system