KEGG   Homo sapiens (human): 7423Help
Entry
7423              CDS       T01001                                 

Gene name
VEGFB, VEGFL, VRF
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  
vascular endothelial growth factor B
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Drug target
Aflibercept: 
Aflibercept beta: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7423 (VEGFB)
   04015 Rap1 signaling pathway
    7423 (VEGFB)
   04010 MAPK signaling pathway
    7423 (VEGFB)
   04151 PI3K-Akt signaling pathway
    7423 (VEGFB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7423 (VEGFB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7423 (VEGFB)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    7423 (VEGFB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7423 (VEGFB)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7423 (VEGFB)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7423 (VEGFB)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   7423 (VEGFB)
  NRP2; neuropilin 2 [KO:K06819]
   7423 (VEGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49765(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 207 aa AA seqDB search
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcactcctgcagctggcccccgcccag
gcccctgtctcccagcctgatgcccctggccaccagaggaaagtggtgtcatggatagat
gtgtatactcgcgctacctgccagccccgggaggtggtggtgcccttgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagccagacagggctgccact
ccccaccaccgtccccagccccgttctgttccgggctgggactctgcccccggagcaccc
tccccagctgacatcacccatcccactccagccccaggcccctctgcccacgctgcaccc
agcaccaccagcgccctgacccccggacctgccgctgccgctgccgacgccgcagcttcc
tccgttgccaagggcggggcttag

DBGET integrated database retrieval system