KEGG   Homo sapiens (human): 7424Help
Entry
7424              CDS       T01001                                 

Gene name
VEGFC, Flt4-L, VRP
Definition
vascular endothelial growth factor C
Orthology
K05449  
vascular endothelial growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Pathways in cancer
Disease
H00018  
Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7424 (VEGFC)
   04015 Rap1 signaling pathway
    7424 (VEGFC)
   04668 TNF signaling pathway
    7424 (VEGFC)
   04151 PI3K-Akt signaling pathway
    7424 (VEGFC)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7424 (VEGFC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7424 (VEGFC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7424 (VEGFC)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7424 (VEGFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q34.3
AA seq 419 aa AA seqDB search
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgctgggcttcttctctgtggcgtgttctctgctcgccgctgcgctgctcccg
ggtcctcgcgaggcgcccgccgccgccgccgccttcgagtccggactcgacctctcggac
gcggagcccgacgcgggcgaggccacggcttatgcaagcaaagatctggaggagcagtta
cggtctgtgtccagtgtagatgaactcatgactgtactctacccagaatattggaaaatg
tacaagtgtcagctaaggaaaggaggctggcaacataacagagaacaggccaacctcaac
tcaaggacagaagagactataaaatttgctgcagcacattataatacagagatcttgaaa
agtattgataatgagtggagaaagactcaatgcatgccacgggaggtgtgtatagatgtg
gggaaggagtttggagtcgcgacaaacaccttctttaaacctccatgtgtgtccgtctac
agatgtgggggttgctgcaatagtgaggggctgcagtgcatgaacaccagcacgagctac
ctcagcaagacgttatttgaaattacagtgcctctctctcaaggccccaaaccagtaaca
atcagttttgccaatcacacttcctgccgatgcatgtctaaactggatgtttacagacaa
gttcattccattattagacgttccctgccagcaacactaccacagtgtcaggcagcgaac
aagacctgccccaccaattacatgtggaataatcacatctgcagatgcctggctcaggaa
gattttatgttttcctcggatgctggagatgactcaacagatggattccatgacatctgt
ggaccaaacaaggagctggatgaagagacctgtcagtgtgtctgcagagcggggcttcgg
cctgccagctgtggaccccacaaagaactagacagaaactcatgccagtgtgtctgtaaa
aacaaactcttccccagccaatgtggggccaaccgagaatttgatgaaaacacatgccag
tgtgtatgtaaaagaacctgccccagaaatcaacccctaaatcctggaaaatgtgcctgt
gaatgtacagaaagtccacagaaatgcttgttaaaaggaaagaagttccaccaccaaaca
tgcagctgttacagacggccatgtacgaaccgccagaaggcttgtgagccaggattttca
tatagtgaagaagtgtgtcgttgtgtcccttcatattggaaaagaccacaaatgagctaa

DBGET integrated database retrieval system