KEGG   Homo sapiens (human): 7424Help
Entry
7424              CDS       T01001                                 

Gene name
VEGFC, Flt4-L, LMPH1D, VRP
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  
vascular endothelial growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Disease
H00018  
Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7424 (VEGFC)
   04015 Rap1 signaling pathway
    7424 (VEGFC)
   04668 TNF signaling pathway
    7424 (VEGFC)
   04151 PI3K-Akt signaling pathway
    7424 (VEGFC)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7424 (VEGFC)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7424 (VEGFC)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    7424 (VEGFC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7424 (VEGFC)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7424 (VEGFC)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7424 (VEGFC)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-9
    ITGB1; integrin beta 1 [KO:K05719]
     7424 (VEGFC)
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   7424 (VEGFC)
  NRP2; neuropilin 2 [KO:K06819]
   7424 (VEGFC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49767(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
4q34.3
AA seq 419 aa AA seqDB search
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgctgggcttcttctctgtggcgtgttctctgctcgccgctgcgctgctcccg
ggtcctcgcgaggcgcccgccgccgccgccgccttcgagtccggactcgacctctcggac
gcggagcccgacgcgggcgaggccacggcttatgcaagcaaagatctggaggagcagtta
cggtctgtgtccagtgtagatgaactcatgactgtactctacccagaatattggaaaatg
tacaagtgtcagctaaggaaaggaggctggcaacataacagagaacaggccaacctcaac
tcaaggacagaagagactataaaatttgctgcagcacattataatacagagatcttgaaa
agtattgataatgagtggagaaagactcaatgcatgccacgggaggtgtgtatagatgtg
gggaaggagtttggagtcgcgacaaacaccttctttaaacctccatgtgtgtccgtctac
agatgtgggggttgctgcaatagtgaggggctgcagtgcatgaacaccagcacgagctac
ctcagcaagacgttatttgaaattacagtgcctctctctcaaggccccaaaccagtaaca
atcagttttgccaatcacacttcctgccgatgcatgtctaaactggatgtttacagacaa
gttcattccattattagacgttccctgccagcaacactaccacagtgtcaggcagcgaac
aagacctgccccaccaattacatgtggaataatcacatctgcagatgcctggctcaggaa
gattttatgttttcctcggatgctggagatgactcaacagatggattccatgacatctgt
ggaccaaacaaggagctggatgaagagacctgtcagtgtgtctgcagagcggggcttcgg
cctgccagctgtggaccccacaaagaactagacagaaactcatgccagtgtgtctgtaaa
aacaaactcttccccagccaatgtggggccaaccgagaatttgatgaaaacacatgccag
tgtgtatgtaaaagaacctgccccagaaatcaacccctaaatcctggaaaatgtgcctgt
gaatgtacagaaagtccacagaaatgcttgttaaaaggaaagaagttccaccaccaaaca
tgcagctgttacagacggccatgtacgaaccgccagaaggcttgtgagccaggattttca
tatagtgaagaagtgtgtcgttgtgtcccttcatattggaaaagaccacaaatgagctaa

DBGET integrated database retrieval system