KEGG   Homo sapiens (human): 7433Help
Entry
7433              CDS       T01001                                 

Gene name
VIPR1, HVR1, II, PACAP-R-2, PACAP-R2, RDC1, V1RG, VAPC1, VIP-R-1, VIPR, VIRG, VPAC1, VPAC1R, VPCAP1R
Definition
vasoactive intestinal peptide receptor 1
Orthology
K04589  
vasoactive intestinal peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22
AA seq 416 aa AA seqDB search
MIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNV
SRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVAT
AILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVF
FQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFE
DYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLAR
STLLLIPLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRR
KWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggtgcagcacaagcagtgcctggaggaggcccagctggagaatgagacaata
ggctgcagcaagatgtgggacaacctcacctgctggccagccacccctcggggccaggta
gttgtcttggcctgtcccctcatcttcaagctcttctcctccattcaaggccgcaatgta
agccgcagctgcaccgacgaaggctggacgcacctggagcctggcccgtaccccattgcc
tgtggtttggatgacaaggcagcgagtttggatgagcagcagaccatgttctacggttct
gtgaagaccggctacaccattggctacggcctgtccctcgccacccttctggtcgccaca
gctatcctgagcctgttcaggaagctccactgcacgcggaactacatccacatgcacctc
ttcatatccttcatcctgagggctgccgctgtcttcatcaaagacttggccctcttcgac
agcggggagtcggaccagtgctccgagggctcggtgggctgtaaggcagccatggtcttt
ttccaatattgtgtcatggctaacttcttctggctgctggtggagggcctctacctgtac
accctgcttgccgtctccttcttctctgagcggaagtacttctgggggtacatactcatc
ggctggggggtacccagcacattcaccatggtgtggaccatcgccaggatccattttgag
gattatgggtgctgggacaccatcaactcctcactgtggtggatcataaagggccccatc
ctcacctccatcttggtaaacttcatcctgtttatttgcatcatccgaatcctgcttcag
aaactgcggcccccagatatcaggaagagtgacagcagtccatactcaaggctagccagg
tccacactcctgctgatccccctgtttggagtacactacatcatgttcgccttctttccg
gacaattttaagcctgaagtgaagatggtctttgagctcgtcgtggggtctttccagggt
tttgtggtggctatcctctactgcttcctcaatggtgaggtgcaggcggagctgaggcgg
aagtggcggcgctggcacctgcagggcgtcctgggctggaaccccaaataccggcacccg
tcgggaggcagcaacggcgccacgtgcagcacgcaggtttccatgctgacccgcgtcagc
ccaggtgcccgccgctcctccagcttccaagccgaagtctccctggtctga

DBGET integrated database retrieval system