KEGG   Homo sapiens (human): 7433Help
Entry
7433              CDS       T01001                                 

Gene name
VIPR1, HVR1, II, PACAP-R-2, PACAP-R2, RDC1, V1RG, VAPC1, VIP-R-1, VIPR, VIRG, VPAC1, VPAC1R, VPCAP1R
Definition
(RefSeq) vasoactive intestinal peptide receptor 1
  KO
K04589  
vasoactive intestinal peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7433 (VIPR1)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide
    7433 (VIPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22
AA seq 457 aa AA seqDB search
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET
IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI
ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH
LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL
YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP
ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF
PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH
PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgccaagtccgctgcccgcccgctggctatgcgtgctggcaggcgccctcgcc
tgggcccttgggccggcgggcggccaggcggccaggctgcaggaggagtgtgactatgtg
cagatgatcgaggtgcagcacaagcagtgcctggaggaggcccagctggagaatgagaca
ataggctgcagcaagatgtgggacaacctcacctgctggccagccacccctcggggccag
gtagttgtcttggcctgtcccctcatcttcaagctcttctcctccattcaaggccgcaat
gtaagccgcagctgcaccgacgaaggctggacgcacctggagcctggcccgtaccccatt
gcctgtggtttggatgacaaggcagcgagtttggatgagcagcagaccatgttctacggt
tctgtgaagaccggctacaccattggctacggcctgtccctcgccacccttctggtcgcc
acagctatcctgagcctgttcaggaagctccactgcacgcggaactacatccacatgcac
ctcttcatatccttcatcctgagggctgccgctgtcttcatcaaagacttggccctcttc
gacagcggggagtcggaccagtgctccgagggctcggtgggctgtaaggcagccatggtc
tttttccaatattgtgtcatggctaacttcttctggctgctggtggagggcctctacctg
tacaccctgcttgccgtctccttcttctctgagcggaagtacttctgggggtacatactc
atcggctggggggtacccagcacattcaccatggtgtggaccatcgccaggatccatttt
gaggattatgggtgctgggacaccatcaactcctcactgtggtggatcataaagggcccc
atcctcacctccatcttggtaaacttcatcctgtttatttgcatcatccgaatcctgctt
cagaaactgcggcccccagatatcaggaagagtgacagcagtccatactcaaggctagcc
aggtccacactcctgctgatccccctgtttggagtacactacatcatgttcgccttcttt
ccggacaattttaagcctgaagtgaagatggtctttgagctcgtcgtggggtctttccag
ggttttgtggtggctatcctctactgcttcctcaatggtgaggtgcaggcggagctgagg
cggaagtggcggcgctggcacctgcagggcgtcctgggctggaaccccaaataccggcac
ccgtcgggaggcagcaacggcgccacgtgcagcacgcaggtttccatgctgacccgcgtc
agcccaggtgcccgccgctcctccagcttccaagccgaagtctccctggtctga

DBGET integrated database retrieval system