KEGG   Homo sapiens (human): 7434Help
Entry
7434              CDS       T01001                                 

Gene name
VIPR2, C16DUPq36.3, DUP7q36.3, PACAP-R-3, PACAP-R3, VIP-R-2, VPAC2, VPAC2R, VPCAP2R
Definition
(RefSeq) vasoactive intestinal peptide receptor 2
  KO
K04590  
vasoactive intestinal peptide receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    7434 (VIPR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7434 (VIPR2)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide
    7434 (VIPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P41587(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.3
AA seq 438 aa AA seqDB search
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI
TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD
DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC
FLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE
LCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
FHRGSRAQSFLQTETSVI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgctgctgcctcccgcgctgctgacctgctggctgctcgcccccgtgaacagc
attcacccagaatgccgatttcatctggaaatacaggaggaagaaacaaaatgtgcagag
cttctgaggtctcaaacagaaaaacacaaagcctgcagtggcgtctgggacaacatcacg
tgctggcggcctgccaatgtgggagagaccgtcacggtgccctgcccaaaagtcttcagc
aatttttacagcaaagcaggaaacataagcaaaaactgtacgagtgacggatggtcagag
acgttcccagatttcgtcgatgcctgtggctacagcgacccggaggatgagagcaagatc
acgttttatattctggtgaaggccatttataccctgggctacagtgtctctctgatgtct
cttgcaacaggaagcataattctgtgcctcttcaggaagctgcactgcaccaggaattac
atccacctgaacctgttcctgtccttcatcctgagagccatctcagtgctggtcaaggac
gacgttctctactccagctctggcacgttgcactgccctgaccagccatcctcctgggtg
ggctgcaagctgagcctggtcttcctgcagtactgcatcatggccaacttcttctggctg
ctggtggaggggctctacctccacaccctcctggtggccatgctcccccctagaaggtgc
ttcctggcctacctcctgatcggatggggcctccccaccgtctgcatcggtgcatggact
gcggccaggctctacttagaagacaccggttgctgggatacaaacgaccacagtgtgccc
tggtgggtcatacgaataccgattttaatttccatcatcgtcaattttgtccttttcatt
agtattatacgaattttgctgcagaagttaacatccccagatgtcggcggcaacgaccag
tctcagtacaagaggctggccaagtccacgctcctgcttatcccgctgttcggcgtccac
tacatggtgtttgccgtgtttcccatcagcatctcctccaaataccagatactgtttgag
ctgtgcctcgggtcgttccagggcctggtggtggccgtcctctactgtttcctgaacagt
gaggtgcagtgcgagctgaagcgaaaatggcgaagccggtgcccgaccccgtccgcgagc
cgggattacagggtctgcggttcctccttctcccgcaacggctcggagggcgccctgcag
ttccaccgcggctcccgcgcccagtccttcctgcaaacggagacctcggtcatctag

DBGET integrated database retrieval system