KEGG   Homo sapiens (human): 7444Help
Entry
7444              CDS       T01001                                 

Gene name
VRK2
Definition
(RefSeq) vaccinia related kinase 2 (EC:2.7.11.1)
  KO
K08816  
vaccinia related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7444 (VRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CK1 group
  VRK family
   7444 (VRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p16.1
AA seq 508 aa AA seqDB search
MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLS
EETNADVYYYRIIIPVLLMLVFLALFFL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaaagaaatgaaaaatacaaacttcctattccatttccagaaggcaaggtt
ctggatgatatggaaggcaatcagtgggtactgggcaagaagattggctctggaggattt
ggattgatatatttagctttccccacaaataaaccagagaaagatgcaagacatgtagta
aaagtggaatatcaagaaaatggcccgttattttcagaacttaaattttatcagagagtt
gcaaaaaaagactgtatcaaaaagtggatagaacgcaaacaacttgattatttaggaatt
cctctgttttatggatctggtctgactgaattcaagggaagaagttacagatttatggta
atggaaagactaggaatagatttacagaagatctcaggccagaatggtacctttaaaaag
tcaactgtcctgcaattaggtatccgaatgttggatgtactggaatatatacatgaaaat
gaatatgttcatggtgatataaaagcagcaaatctacttttgggttacaaaaatccagac
caggtttatcttgcagattatggactttcctacagatattgtcccaatgggaaccacaaa
cagtatcaggaaaatcctagaaaaggccataatgggacaatagagtttaccagcttggat
gcccacaagggagtagccttgtccagacgaagtgacgttgagatcctcggctactgcatg
ctgcggtggttgtgtgggaaacttccctgggaacagaacctgaaggaccctgtggctgtg
cagactgctaaaacaaatctgttggacgagctcccccagtcagtgcttaaatgggctcct
tctggaagcagttgctgtgaaatagcccaatttttggtatgtgctcatagtttagcatat
gatgaaaagccaaactatcaagccctcaagaaaattttgaaccctcatggaataccttta
ggaccactggacttttccacaaaaggacagagtataaatgtccatactccaaacagtcaa
aaagttgattcacaaaaggctgcaacaaagcaagtcaacaaggcacacaataggttaatc
gaaaaaaaagtccacagtgagagaagcgctgagtcctgtgcaacatggaaagtgcagaaa
gaggagaaactgattggattgatgaacaatgaagcagctcaggaaagcacaaggagaaga
cagaaatatcaagagtctcaagaacctttgaatgaagtaaacagtttcccacaaaaaatc
agctatacacaattcccaaactcattttatgagcctcatcaagattttaccagtccagat
atattcaagaagtcaagatctccatcttggtataaatacacttccacagtcagcacgggg
atcacagacttagaaagttcaactggactttggcctacaatttcccagtttactcttagt
gaagagacaaacgcagatgtttattattatcgcatcatcatacctgtccttttgatgtta
gtatttcttgctttattttttctctga

DBGET integrated database retrieval system