KEGG   Homo sapiens (human): 7450Help
Entry
7450              CDS       T01001                                 

Gene name
VWF, F8VWF, VWD
Definition
von Willebrand factor
Orthology
K03900  
von Willebrand factor
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Platelet activation
Disease
H00219  
Hemophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7450 (VWF)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7450 (VWF)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    7450 (VWF)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    7450 (VWF)
   04611 Platelet activation
    7450 (VWF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7450 (VWF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.3
AA seq 2813 aa AA seqDB search
MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL
LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG
TSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDVQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ
CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE
TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY
LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY
ECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE
VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVE
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE
YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI
TLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL
SSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVA
FVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGD
ILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLP
GDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL
SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITT
IDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV
TDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTM
VTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD
RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNK
EQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEV
NVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD
GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFY
AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC
DGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQI
CTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHC
ERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN
STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAV
MGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ
WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERME
ACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC
CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHK
CLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMY
SIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
NT seq 8442 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgccagatttgccggggtgctgcttgctctggccctcattttgccagggacc
ctttgtgcagaaggaactcgcggcaggtcatccacggcccgatgcagccttttcggaagt
gacttcgtcaacacctttgatgggagcatgtacagctttgcgggatactgcagttacctc
ctggcagggggctgccagaaacgctccttctcgattattggggacttccagaatggcaag
agagtgagcctctccgtgtatcttggggaattttttgacatccatttgtttgtcaatggt
accgtgacacagggggaccaaagagtctccatgccctatgcctccaaagggctgtatcta
gaaactgaggctgggtactacaagctgtccggtgaggcctatggctttgtggccaggatc
gatggcagcggcaactttcaagtcctgctgtcagacagatacttcaacaagacctgcggg
ctgtgtggcaactttaacatctttgctgaagatgactttatgacccaagaagggaccttg
acctcggacccttatgactttgccaactcatgggctctgagcagtggagaacagtggtgt
gaacgggcatctcctcccagcagctcatgcaacatctcctctggggaaatgcagaagggc
ctgtgggagcagtgccagcttctgaagagcacctcggtgtttgcccgctgccaccctctg
gtggaccccgagccttttgtggccctgtgtgagaagactttgtgtgagtgtgctgggggg
ctggagtgcgcctgccctgccctcctggagtacgcccggacctgtgcccaggagggaatg
gtgctgtacggctggaccgaccacagcgcgtgcagcccagtgtgccctgctggtatggag
tataggcagtgtgtgtccccttgcgccaggacctgccagagcctgcacatcaatgaaatg
tgtcaggagcgatgcgtggatggctgcagctgccctgagggacagctcctggatgaaggc
ctctgcgtggagagcaccgagtgtccctgcgtgcattccggaaagcgctaccctcccggc
acctccctctctcgagactgcaacacctgcatttgccgaaacagccagtggatctgcagc
aatgaagaatgtccaggggagtgccttgtcacaggtcaatcacacttcaagagctttgac
aacagatacttcaccttcagtgggatctgccagtacctgctggcccgggattgccaggac
cactccttctccattgtcattgagactgtccagtgtgctgatgaccgcgacgctgtgtgc
acccgctccgtcaccgtccggctgcctggcctgcacaacagccttgtgaaactgaagcat
ggggcaggagttgccatggatggccaggacgtccagctccccctcctgaaaggtgacctc
cgcatccagcatacagtgacggcctccgtgcgcctcagctacggggaggacctgcagatg
gactgggatggccgcgggaggctgctggtgaagctgtcccccgtctatgccgggaagacc
tgcggcctgtgtgggaattacaatggcaaccagggcgacgacttccttaccccctctggg
ctggcggagccccgggtggaggacttcgggaacgcctggaagctgcacggggactgccag
gacctgcagaagcagcacagcgatccctgcgccctcaacccgcgcatgaccaggttctcc
gaggaggcgtgcgcggtcctgacgtcccccacattcgaggcctgccatcgtgccgtcagc
ccgctgccctacctgcggaactgccgctacgacgtgtgctcctgctcggacggccgcgag
tgcctgtgcggcgccctggccagctatgccgcggcctgcgcggggagaggcgtgcgcgtc
gcgtggcgcgagccaggccgctgtgagctgaactgcccgaaaggccaggtgtacctgcag
tgcgggaccccctgcaacctgacctgccgctctctctcttacccggatgaggaatgcaat
gaggcctgcctggagggctgcttctgccccccagggctctacatggatgagaggggggac
tgcgtgcccaaggcccagtgcccctgttactatgacggtgagatcttccagccagaagac
atcttctcagaccatcacaccatgtgctactgtgaggatggcttcatgcactgtaccatg
agtggagtccccggaagcttgctgcctgacgctgtcctcagcagtcccctgtctcatcgc
agcaaaaggagcctatcctgtcggccccccatggtcaagctggtgtgtcccgctgacaac
ctgcgggctgaagggctcgagtgtaccaaaacgtgccagaactatgacctggagtgcatg
agcatgggctgtgtctctggctgcctctgccccccgggcatggtccggcatgagaacaga
tgtgtggccctggaaaggtgtccctgcttccatcagggcaaggagtatgcccctggagaa
acagtgaagattggctgcaacacttgtgtctgtcgggaccggaagtggaactgcacagac
catgtgtgtgatgccacgtgctccacgatcggcatggcccactacctcaccttcgacggg
ctcaaatacctgttccccggggagtgccagtacgttctggtgcaggattactgcggcagt
aaccctgggacctttcggatcctagtggggaataagggatgcagccacccctcagtgaaa
tgcaagaaacgggtcaccatcctggtggagggaggagagattgagctgtttgacggggag
gtgaatgtgaagaggcccatgaaggatgagactcactttgaggtggtggagtctggccgg
tacatcattctgctgctgggcaaagccctctccgtggtctgggaccgccacctgagcatc
tccgtggtcctgaagcagacataccaggagaaagtgtgtggcctgtgtgggaattttgat
ggcatccagaacaatgacctcaccagcagcaacctccaagtggaggaagaccctgtggac
tttgggaactcctggaaagtgagctcgcagtgtgctgacaccagaaaagtgcctctggac
tcatcccctgccacctgccataacaacatcatgaagcagacgatggtggattcctcctgt
agaatccttaccagtgacgtcttccaggactgcaacaagctggtggaccccgagccatat
ctggatgtctgcatttacgacacctgctcctgtgagtccattggggactgcgcctgcttc
tgcgacaccattgctgcctatgcccacgtgtgtgcccagcatggcaaggtggtgacctgg
aggacggccacattgtgcccccagagctgcgaggagaggaatctccgggagaacgggtat
gagtgtgagtggcgctataacagctgtgcacctgcctgtcaagtcacgtgtcagcaccct
gagccactggcctgccctgtgcagtgtgtggagggctgccatgcccactgccctccaggg
aaaatcctggatgagcttttgcagacctgcgttgaccctgaagactgtccagtgtgtgag
gtggctggccggcgttttgcctcaggaaagaaagtcaccttgaatcccagtgaccctgag
cactgccagatttgccactgtgatgttgtcaacctcacctgtgaagcctgccaggagccg
ggaggcctggtggtgcctcccacagatgccccggtgagccccaccactctgtatgtggag
gacatctcggaaccgccgttgcacgatttctactgcagcaggctactggacctggtcttc
ctgctggatggctcctccaggctgtccgaggctgagtttgaagtgctgaaggcctttgtg
gtggacatgatggagcggctgcgcatctcccagaagtgggtccgcgtggccgtggtggag
taccacgacggctcccacgcctacatcgggctcaaggaccggaagcgaccgtcagagctg
cggcgcattgccagccaggtgaagtatgcgggcagccaggtggcctccaccagcgaggtc
ttgaaatacacactgttccaaatcttcagcaagatcgaccgccctgaagcctcccgcatc
accctgctcctgatggccagccaggagccccaacggatgtcccggaactttgtccgctac
gtccagggcctgaagaagaagaaggtcattgtgatcccggtgggcattgggccccatgcc
aacctcaagcagatccgcctcatcgagaagcaggcccctgagaacaaggccttcgtgctg
agcagtgtggatgagctggagcagcaaagggacgagatcgttagctacctctgtgacctt
gcccctgaagcccctcctcctactctgccccccgacatggcacaagtcactgtgggcccg
gggctcttgggggtttcgaccctggggcccaagaggaactccatggttctggatgtggcg
ttcgtcctggaaggatcggacaaaattggtgaagccgacttcaacaggagcaaggagttc
atggaggaggtgattcagcggatggatgtgggccaggacagcatccacgtcacggtgctg
cagtactcctacatggtgactgtggagtaccccttcagcgaggcacagtccaaaggggac
atcctgcagcgggtgcgagagatccgctaccagggcggcaacaggaccaacactgggctg
gccctgcggtacctctctgaccacagcttcttggtcagccagggtgaccgggagcaggcg
cccaacctggtctacatggtcaccggaaatcctgcctctgatgagatcaagaggctgcct
ggagacatccaggtggtgcccattggagtgggccctaatgccaacgtgcaggagctggag
aggattggctggcccaatgcccctatcctcatccaggactttgagacgctcccccgagag
gctcctgacctggtgctgcagaggtgctgctccggagaggggctgcagatccccaccctc
tcccctgcacctgactgcagccagcccctggacgtgatccttctcctggatggctcctcc
agtttcccagcttcttattttgatgaaatgaagagtttcgccaaggctttcatttcaaaa
gccaatatagggcctcgtctcactcaggtgtcagtgctgcagtatggaagcatcaccacc
attgacgtgccatggaacgtggtcccggagaaagcccatttgctgagccttgtggacgtc
atgcagcgggagggaggccccagccaaatcggggatgccttgggctttgctgtgcgatac
ttgacttcagaaatgcatggtgccaggccgggagcctcaaaggcggtggtcatcctggtc
acggacgtctctgtggattcagtggatgcagcagctgatgccgccaggtccaacagagtg
acagtgttccctattggaattggagatcgctacgatgcagcccagctacggatcttggca
ggcccagcaggcgactccaacgtggtgaagctccagcgaatcgaagacctccctaccatg
gtcaccttgggcaattccttcctccacaaactgtgctctggatttgttaggatttgcatg
gatgaggatgggaatgagaagaggcccggggacgtctggaccttgccagaccagtgccac
accgtgacttgccagccagatggccagaccttgctgaagagtcatcgggtcaactgtgac
cgggggctgaggccttcgtgccctaacagccagtcccctgttaaagtggaagagacctgt
ggctgccgctggacctgcccctgcgtgtgcacaggcagctccactcggcacatcgtgacc
tttgatgggcagaatttcaagctgactggcagctgttcttatgtcctatttcaaaacaag
gagcaggacctggaggtgattctccataatggtgcctgcagccctggagcaaggcagggc
tgcatgaaatccatcgaggtgaagcacagtgccctctccgtcgagctgcacagtgacatg
gaggtgacggtgaatgggagactggtctctgttccttacgtgggtgggaacatggaagtc
aacgtttatggtgccatcatgcatgaggtcagattcaatcaccttggtcacatcttcaca
ttcactccacaaaacaatgagttccaactgcagctcagccccaagacttttgcttcaaag
acgtatggtctgtgtgggatctgtgatgagaacggagccaatgacttcatgctgagggat
ggcacagtcaccacagactggaaaacacttgttcaggaatggactgtgcagcggccaggg
cagacgtgccagcccatcctggaggagcagtgtcttgtccccgacagctcccactgccag
gtcctcctcttaccactgtttgctgaatgccacaaggtcctggctccagccacattctat
gccatctgccagcaggacagttgccaccaggagcaagtgtgtgaggtgatcgcctcttat
gcccacctctgtcggaccaacggggtctgcgttgactggaggacacctgatttctgtgct
atgtcatgcccaccatctctggtctacaaccactgtgagcatggctgtccccggcactgt
gatggcaacgtgagctcctgtggggaccatccctccgaaggctgtttctgccctccagat
aaagtcatgttggaaggcagctgtgtccctgaagaggcctgcactcagtgcattggtgag
gatggagtccagcaccagttcctggaagcctgggtcccggaccaccagccctgtcagatc
tgcacatgcctcagcgggcggaaggtcaactgcacaacgcagccctgccccacggccaaa
gctcccacgtgtggcctgtgtgaagtagcccgcctccgccagaatgcagaccagtgctgc
cccgagtatgagtgtgtgtgtgacccagtgagctgtgacctgcccccagtgcctcactgt
gaacgtggcctccagcccacactgaccaaccctggcgagtgcagacccaacttcacctgc
gcctgcaggaaggaggagtgcaaaagagtgtccccaccctcctgccccccgcaccgtttg
cccacccttcggaagacccagtgctgtgatgagtatgagtgtgcctgcaactgtgtcaac
tccacagtgagctgtccccttgggtacttggcctcaactgccaccaatgactgtggctgt
accacaaccacctgccttcccgacaaggtgtgtgtccaccgaagcaccatctaccctgtg
ggccagttctgggaggagggctgcgatgtgtgcacctgcaccgacatggaggatgccgtg
atgggcctccgcgtggcccagtgctcccagaagccctgtgaggacagctgtcggtcgggc
ttcacttacgttctgcatgaaggcgagtgctgtggaaggtgcctgccatctgcctgtgag
gtggtgactggctcaccgcggggggactcccagtcttcctggaagagtgtcggctcccag
tgggcctccccggagaacccctgcctcatcaatgagtgtgtccgagtgaaggaggaggtc
tttatacaacaaaggaacgtctcctgcccccagctggaggtccctgtctgcccctcgggc
tttcagctgagctgtaagacctcagcgtgctgcccaagctgtcgctgtgagcgcatggag
gcctgcatgctcaatggcactgtcattgggcccgggaagactgtgatgatcgatgtgtgc
acgacctgccgctgcatggtgcaggtgggggtcatctctggattcaagctggagtgcagg
aagaccacctgcaacccctgccccctgggttacaaggaagaaaataacacaggtgaatgt
tgtgggagatgtttgcctacggcttgcaccattcagctaagaggaggacagatcatgaca
ctgaagcgtgatgagacgctccaggatggctgtgatactcacttctgcaaggtcaatgag
agaggagagtacttctgggagaagagggtcacaggctgcccaccctttgatgaacacaag
tgtctggctgagggaggtaaaattatgaaaattccaggcacctgctgtgacacatgtgag
gagcctgagtgcaacgacatcactgccaggctgcagtatgtcaaggtgggaagctgtaag
tctgaagtagaggtggatatccactactgccagggcaaatgtgccagcaaagccatgtac
tccattgacatcaacgatgtgcaggaccagtgctcctgctgctctccgacacggacggag
cccatgcaggtggccctgcactgcaccaatggctctgttgtgtaccatgaggttctcaat
gccatggagtgcaaatgctcccccaggaagtgcagcaagtga

DBGET integrated database retrieval system