KEGG   Homo sapiens (human): 7453Help
Entry
7453              CDS       T01001                                 

Gene name
WARS, GAMMA-2, IFI53, IFP53
Definition
tryptophanyl-tRNA synthetase (EC:6.1.1.2)
Orthology
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.31
AA seq 471 aa AA seqDB search
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA
DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
ERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT
KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIF
LTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacagtgagcccgcatctctgctggagctgttcaacagcatcgccacacaaggg
gagctcgtaaggtccctcaaagcgggaaatgcgtcaaaggatgaaattgattctgcagta
aagatgttggtgtcattaaaaatgagctacaaagctgccgcgggggaggattacaaggct
gactgtcctccagggaacccagcacctaccagtaatcatggcccagatgccacagaagct
gaagaggattttgtggacccatggacagtacagacaagcagtgcaaaaggcatagactac
gataagctcattgttcggtttggaagtagtaaaattgacaaagagctaataaaccgaata
gagagagccaccggccaaagaccacaccacttcctgcgcagaggcatcttcttctcacac
agagatatgaatcaggttcttgatgcctatgaaaataagaagccattttatctgtacacg
ggccggggcccctcttctgaagcaatgcatgtaggtcacctcattccatttattttcaca
aagtggctccaggatgtatttaacgtgcccttggtcatccagatgacggatgacgagaag
tatctgtggaaggacctgaccctggaccaggcctatagctatgctgtggagaatgccaag
gacatcatcgcctgtggctttgacatcaacaagactttcatattctctgacctggactac
atggggatgagctcaggtttctacaaaaatgtggtgaagattcaaaagcatgttaccttc
aaccaagtgaaaggcattttcggcttcactgacagcgactgcattgggaagatcagtttt
cctgccatccaggctgctccctccttcagcaactcattcccacagatcttccgagacagg
acggatatccagtgccttatcccatgtgccattgaccaggatccttactttagaatgaca
agggacgtcgcccccaggatcggctatcctaaaccagccctgctgcactccaccttcttc
ccagccctgcagggcgcccagaccaaaatgagtgccagcgaccccaactcctccatcttc
ctcaccgacacggccaagcagatcaaaaccaaggtcaataagcatgcgttttctggaggg
agagacaccatcgaggagcacaggcagtttgggggcaactgtgatgtggacgtgtctttc
atgtacctgaccttcttcctcgaggacgacgacaagctcgagcagatcaggaaggattac
accagcggagccatgctcaccggtgagctcaagaaggcactcatagaggttctgcagccc
ttgatcgcagagcaccaggcccggcgcaaggaggtcacggatgagatagtgaaagagttc
atgactccccggaagctgtccttcgactttcagtag

DBGET integrated database retrieval system