KEGG   Homo sapiens (human): 7453Help
Entry
7453              CDS       T01001                                 

Gene name
WARS, GAMMA-2, IFI53, IFP53
Definition
tryptophanyl-tRNA synthetase (EC:6.1.1.2)
Orthology
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    7453 (WARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     7453 (WARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   7453 (WARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    7453 (WARS)
 Prokaryotic Type
    7453 (WARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.31
AA seq 471 aa AA seqDB search
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA
DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
ERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT
KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIF
LTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacagtgagcccgcatctctgctggagctgttcaacagcatcgccacacaaggg
gagctcgtaaggtccctcaaagcgggaaatgcgtcaaaggatgaaattgattctgcagta
aagatgttggtgtcattaaaaatgagctacaaagctgccgcgggggaggattacaaggct
gactgtcctccagggaacccagcacctaccagtaatcatggcccagatgccacagaagct
gaagaggattttgtggacccatggacagtacagacaagcagtgcaaaaggcatagactac
gataagctcattgttcggtttggaagtagtaaaattgacaaagagctaataaaccgaata
gagagagccaccggccaaagaccacaccacttcctgcgcagaggcatcttcttctcacac
agagatatgaatcaggttcttgatgcctatgaaaataagaagccattttatctgtacacg
ggccggggcccctcttctgaagcaatgcatgtaggtcacctcattccatttattttcaca
aagtggctccaggatgtatttaacgtgcccttggtcatccagatgacggatgacgagaag
tatctgtggaaggacctgaccctggaccaggcctatagctatgctgtggagaatgccaag
gacatcatcgcctgtggctttgacatcaacaagactttcatattctctgacctggactac
atggggatgagctcaggtttctacaaaaatgtggtgaagattcaaaagcatgttaccttc
aaccaagtgaaaggcattttcggcttcactgacagcgactgcattgggaagatcagtttt
cctgccatccaggctgctccctccttcagcaactcattcccacagatcttccgagacagg
acggatatccagtgccttatcccatgtgccattgaccaggatccttactttagaatgaca
agggacgtcgcccccaggatcggctatcctaaaccagccctgctgcactccaccttcttc
ccagccctgcagggcgcccagaccaaaatgagtgccagcgaccccaactcctccatcttc
ctcaccgacacggccaagcagatcaaaaccaaggtcaataagcatgcgttttctggaggg
agagacaccatcgaggagcacaggcagtttgggggcaactgtgatgtggacgtgtctttc
atgtacctgaccttcttcctcgaggacgacgacaagctcgagcagatcaggaaggattac
accagcggagccatgctcaccggtgagctcaagaaggcactcatagaggttctgcagccc
ttgatcgcagagcaccaggcccggcgcaaggaggtcacggatgagatagtgaaagagttc
atgactccccggaagctgtccttcgactttcagtag

DBGET integrated database retrieval system