KEGG   Homo sapiens (human): 7468Help
Entry
7468              CDS       T01001                                 

Gene name
WHSC1, MMSET, NSD2, REIIBP, TRX5, WHS
Definition
Wolf-Hirschhorn syndrome candidate 1 (EC:2.1.1.43)
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Disease
H00010  
Multiple myeloma
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 1365 aa AA seqDB search
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGK
STPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaagcagagtcccctttctgttcagagtgttgtaaagtgcataaag
atgaagcaggcaccagaaatcctcggcagtgccaacgggaagactccgagctgcgaggtg
aaccgcgagtgttctgtgttcctcagcaaagcccagctctccagtagcctgcaggagggg
gtcatgcagaagtttaacggccacgacgccctgccctttattccagccgacaagctgaaa
gatcttacttcccgggtgtttaatggagaacccggcgcacacgatgccaaactgcgtttt
gagtcccaggaaatgaaagggattgggacaccccctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacatacatgaatgggaagcctctctttgaa
tcttccatttgtggtgacagtgctgctgatgtgtctcagtcagaagaaaatggacaaaaa
ccagaaaacaaggcgagaaggaacaggaagaggagcataaaatatgactccttgctggag
cagggccttgtcgaagcagctcttgtgtctaagatctcaagtccttcagataaaaagatt
ccagctaagaaagagtcttgtccaaacactggaagagacaaagaccacctgttgaaatac
aacgttggtgatttggtgtggtccaaagtgtcgggttacccttggtggccttgcatggtt
tctgcagatccactccttcacagctataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgacgccccagaaagagcttggatatttgagaagagc
ctcgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctattgaaaccaatttcagggaaattgagggcc
cagtgggaaatgggcattgttcaagcagaagaagctgcaagcatgtcagtggaggagcgg
aaagccaagttcacctttctctatgtgggggaccagcttcatctcaaccctcaagtagcc
aaggaggctggcattgctgcagagtctttgggagaaatggcagaatcctcaggagtcagt
gaagaagctgctgaaaaccccaagtctgtgagagaagagtgcattcccatgaagagaagg
cggagggccaaactgtgtagctctgcagagaccctggagagtcaccccgacatagggaag
agtactcctcaaaagacggcagaggctgaccccagaagaggagtagggtctcctcctggg
aggaagaagaccacagtctccatgccacgaagcaggaagggagatgcagcatcccagttt
ttggtcttctgtcaaaaacacagggatgaggtggtagctgagcacccagatgcttcaggt
gaggagattgaagagctgctcaggtcacagtggagtctgctgagtgagaagcagagagca
cgctacaacaccaagtttgccctggtggcccctgtccaggctgaagaagactctggtaat
gtaaatgggaaaaaaagaaaccacacaaagaggatacaggaccctacagaagatgctgaa
gctgaggacacacccaggaaaagactcaggacggacaagcacagtcttcggaagagagac
acaatcactgacaaaacggccagaacaagctcttacaaggccatggaggcagcctcctcg
ctcaagagccaggcagcaacgaaaaatctgtctgatgcatgtaaaccactgaagaagcga
aatcgggcttccacggcagcatcttcagctcttgggtttagcaaaagttcatctccttct
gcatccttaactgagaatgaggtctcggacagcccgggagacgagccctcggagtcccca
tacgaaagtgcagacgaaacacaaactgaagtatctgtctcatccaaaaagtctgagcga
ggagtgactgccaaaaaggagtatgtgtgccagctgtgtgagaagccgggcagcctcctg
ctctgtgaaggaccctgctgcggagctttccacctcgcctgccttgggctttcccggagg
ccagaagggaggttcacctgcagcgagtgtgcctcagggattcactcatgtttcgtgtgt
aaagagagcaagacagatgttaagcgctgtgtggtaactcagtgtggaaaattttaccat
gaggcttgtgtgaaaaaataccctctgactgtatttgagagccgaggtttccgctgcccc
ctccacagctgtgtgagctgccatgcttccaacccttcaaacccaaggccgtcaaaaggt
aaaatgatgcggtgtgtccgctgccccgttgcctatcacagcggggatgcttgtctggca
gcaggatgctcagtgatcgcctccaacagcatcatctgcactgcccacttcactgctcgg
aaggggaagcgacaccacgcccacgtcaacgtgagctggtgcttcgtgtgctccaaaggg
gggagccttctgtgctgtgagtcctgcccagcggccttccaccctgactgcctgaacatc
gagatgcctgacggcagctggttctgcaatgactgcagggctgggaagaagctgcacttc
caggatatcatttgggtgaaacttgggaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgtg
tttttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcactgcaagaagctgaagctcgttttcgtgaaattaagcttcagagggaagcccgagaa
acacaggagagcgagcgcaagcccccaccatacaagcacatcaaggtgaataagccttac
gggaaagtccagatctacacagcggatatttcagaaatccctaagtgcaactgcaagccc
acagatgagaatccttgtggctttgattcggagtgtctgaacaggatgctgatgtttgag
tgccacccgcaggtgtgtcccgcgggcgagttctgccagaaccagtgcttcaccaagcgc
cagtacccagagaccaagatcatcaagacagatggcaaagggtggggcctggtcgccaag
agggacatcagaaagggagaatttgttaacgagtacgttggggagctgatcgacgaggag
gagtgcatggcgagaatcaagcacgcacacgagaacgacatcacccacttctacatgctc
actatagacaaggaccgtataatagacgctggccccaaaggaaactactctcgatttatg
aatcacagctgccagcccaactgtgagaccctcaagtggacagtgaatggggacactcgt
gtgggcctgtttgccgtctgtgacattcctgcagggacggagctgacttttaactacaac
ctcgattgtctgggcaatgaaaaaacggtctgccggtgtggagcctccaattgcagtgga
ttcctcggggatagaccaaagacctcgacgaccctttcatcagaggaaaagggcaaaaag
accaagaagaaaacgaggcggcgcagagcaaaaggggaagggaagaggcagtcagaggac
gagtgcttccgctgcggtgatggcgggcagctggtgctgtgtgaccgcaagttctgcacc
aaggcctaccacctgtcctgcctgggccttggcaagcggcccttcgggaagtgggaatgt
ccttggcatcattgtgacgtgtgtggcaaaccttcgacttcattttgccacctctgcccc
aattcgttctgtaaggagcaccaggacgggacagccttcagctgcaccccggacgggcgg
tcctactgctgtgagcatgacttaggggcggcatcggtcagaagcaccaagactgagaag
ccccccccagagccagggaagccgaaggggaagaggcggcggcggaggggctggcggaga
gtcacagagggcaaatag

DBGET integrated database retrieval system