KEGG   Homo sapiens (human): 7471Help
Entry
7471              CDS       T01001                                 

Gene name
WNT1, BMND16, INT1, OI15
Definition
wingless-type MMTV integration site family, member 1
Orthology
K03209  
wingless-type MMTV integration site family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12q13
AA seq 370 aa AA seqDB search
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

DBGET integrated database retrieval system