KEGG   Homo sapiens (human): 7472Help
Entry
7472              CDS       T01001                                 

Gene name
WNT2, INT1L1, IRP
Definition
(RefSeq) Wnt family member 2
  KO
K00182  
wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7472 (WNT2)
   04390 Hippo signaling pathway
    7472 (WNT2)
   04150 mTOR signaling pathway
    7472 (WNT2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7472 (WNT2)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7472 (WNT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7472 (WNT2)
   05205 Proteoglycans in cancer
    7472 (WNT2)
   05217 Basal cell carcinoma
    7472 (WNT2)
   05224 Breast cancer
    7472 (WNT2)
  Infectious diseases
   05166 HTLV-I infection
    7472 (WNT2)
   05165 Human papillomavirus infection
    7472 (WNT2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens (General comment) Effective diffusion, tissue differentiation, development
   7472 (WNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P09544(Tbio)
UniProt: 
Position
7q31.2
AA seq 360 aa AA seqDB search
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcagaatgccagcaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctttttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcctgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaaaggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgtgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtgggtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaagctctggatgtgcacacatgcaaggcccccaagaacgctgactggacaaccgctaca
tga

DBGET integrated database retrieval system