KEGG   Homo sapiens (human): 7473Help
Entry
7473              CDS       T01001                                 

Gene name
WNT3, INT4
Definition
wingless-type MMTV integration site family, member 3
Orthology
K00312  
wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Basal cell carcinoma
Disease
H00636  
Tetra-amelia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7473 (WNT3)
   04340 Hedgehog signaling pathway
    7473 (WNT3)
   04390 Hippo signaling pathway
    7473 (WNT3)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7473 (WNT3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7473 (WNT3)
   05206 MicroRNAs in cancer
    7473 (WNT3)
   05205 Proteoglycans in cancer
    7473 (WNT3)
   05217 Basal cell carcinoma
    7473 (WNT3)
  Infectious diseases
   05166 HTLV-I infection
    7473 (WNT3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7473 (WNT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 355 aa AA seqDB search
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgttcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggcgtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggtgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccacggagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system