KEGG   Homo sapiens (human): 7476Help
Entry
7476              CDS       T01001                                 

Gene name
WNT7A
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing's syndrome
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00846  Fuhrmann syndrome
H00847  Al-Awadi/Raas-Rothschild syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7476 (WNT7A)
   04390 Hippo signaling pathway
    7476 (WNT7A)
   04150 mTOR signaling pathway
    7476 (WNT7A)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7476 (WNT7A)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7476 (WNT7A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7476 (WNT7A)
   05205 Proteoglycans in cancer
    7476 (WNT7A)
   05225 Hepatocellular carcinoma
    7476 (WNT7A)
   05226 Gastric cancer
    7476 (WNT7A)
   05217 Basal cell carcinoma
    7476 (WNT7A)
   05224 Breast cancer
    7476 (WNT7A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    7476 (WNT7A)
  Infectious diseases
   05166 HTLV-I infection
    7476 (WNT7A)
   05165 Human papillomavirus infection
    7476 (WNT7A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens (General comment) Effective diffusion, tissue differentiation, development
   7476 (WNT7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt COG6
Motif
Other DBs
NCBI-GeneID: 7476
NCBI-ProteinID: NP_004616
OMIM: 601570
HGNC: 12786
Ensembl: ENSG00000154764
Vega: OTTHUMG00000129803
Pharos: O00755(Tbio)
UniProt: O00755
Position
3p25.1
AA seq 349 aa AA seqDB search
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcgttcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaacaacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

DBGET integrated database retrieval system