KEGG   Homo sapiens (human): 7476Help
Entry
7476              CDS       T01001                                 

Gene name
WNT7A
Definition
wingless-type MMTV integration site family, member 7A
Orthology
K00572  
wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Disease
H00846  
Fuhrmann syndrome
H00847  
Al-Awadi/Raas-Rothschild syndrome
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p25
AA seq 349 aa AA seqDB search
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcgttcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaacaacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

DBGET integrated database retrieval system