KEGG   Homo sapiens (human): 7476Help
Entry
7476              CDS       T01001                                 

Gene name
WNT7A
Definition
wingless-type MMTV integration site family, member 7A
Orthology
K00572  
wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Disease
H00846  
Fuhrmann syndrome
H00847  
Al-Awadi/Raas-Rothschild syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7476 (WNT7A)
   04340 Hedgehog signaling pathway
    7476 (WNT7A)
   04390 Hippo signaling pathway
    7476 (WNT7A)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7476 (WNT7A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7476 (WNT7A)
   05205 Proteoglycans in cancer
    7476 (WNT7A)
   05217 Basal cell carcinoma
    7476 (WNT7A)
  Infectious diseases
   05166 HTLV-I infection
    7476 (WNT7A)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7476 (WNT7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3p25
AA seq 349 aa AA seqDB search
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcgttcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaacaacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

DBGET integrated database retrieval system