KEGG   Homo sapiens (human): 7477Help
Entry
7477              CDS       T01001                                 

Gene name
WNT7B
Definition
wingless-type MMTV integration site family, member 7B
Orthology
K00572  
wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7477 (WNT7B)
   04340 Hedgehog signaling pathway
    7477 (WNT7B)
   04390 Hippo signaling pathway
    7477 (WNT7B)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    7477 (WNT7B)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7477 (WNT7B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7477 (WNT7B)
   05205 Proteoglycans in cancer
    7477 (WNT7B)
   05217 Basal cell carcinoma
    7477 (WNT7B)
  Infectious diseases
   05166 HTLV-I infection
    7477 (WNT7B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7477 (WNT7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13
AA seq 349 aa AA seqDB search
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaaactttcgcaagtggattttctacgtgtttctctgctttggcgtcctgtac
gtgaagctcggagcactgtcatccgtggtggccctgggagccaacatcatctgcaacaag
attcctggcctagccccgcggcagcgtgccatctgccagagtcggcccgatgccatcatt
gtgattggggagggggcgcagatgggcatcaacgagtgccagtaccagttccgcttcgga
cgctggaactgctctgccctcggcgagaagaccgtcttcgggcaagagctccgagtaggg
agccgtgaggctgccttcacgtacgccatcaccgcggctggcgtggcgcacgccgtcacc
gctgcctgcagccaagggaacctgagcaactgcggctgcgaccgcgagaagcagggctac
tacaaccaagccgagggctggaagtggggcggctgctcggccgacgtgcgttacggcatc
gacttctcccggcgcttcgtggacgctcgggagatcaagaagaacgcgcggcgcctcatg
aacctgcataacaatgaggccggcaggaaggttctagaggaccggatgcagctggagtgc
aagtgccacggcgtgtctggctcctgcaccaccaaaacctgctggaccacgctgcccaag
ttccgagaggtgggccacctgctgaaggagaagtacaacgcggccgtgcaggtggaggtg
gtgcgggccagccgtctgcggcagcccaccttcctgcgcatcaaacagctgcgcagctat
cagaagcccatggagacagacctggtgtacattgagaagtcgcccaactactgcgaggag
gacgcggccacgggcagcgtgggcacgcagggccgtctctgcaaccgcacgtcgcccggc
gcggacggctgtgacaccatgtgctgcggccgaggctacaacacccaccagtacaccaag
gtgtggcagtgcaactgcaaattccactggtgctgcttcgtcaagtgcaacacctgcagc
gagcgcaccgaggtcttcacctgcaagtga

DBGET integrated database retrieval system