KEGG   Homo sapiens (human): 7479Help
Entry
7479              CDS       T01001                                 

Gene name
WNT8B
Definition
wingless-type MMTV integration site family, member 8B
Orthology
K00714  
wingless-type MMTV integration site family, member 8
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7479 (WNT8B)
   04340 Hedgehog signaling pathway
    7479 (WNT8B)
   04390 Hippo signaling pathway
    7479 (WNT8B)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    7479 (WNT8B)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7479 (WNT8B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7479 (WNT8B)
   05205 Proteoglycans in cancer
    7479 (WNT8B)
   05217 Basal cell carcinoma
    7479 (WNT8B)
  Infectious diseases
   05166 HTLV-I infection
    7479 (WNT8B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7479 (WNT8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24
AA seq 351 aa AA seqDB search
MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttcaaagccttctgtgtacatctgtcttttcacctgtgtcctccaactcagc
cacagctggtcggtgaacaatttcctgatgactggtccaaaggcttacctgatttactcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagccctgcagctgtccagccatggtgggcttcgcagt
gccaatcgggagacagcatttgtgcatgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaacggg
caactggggggacaaggctggctgtggggaggctgcagtgacaatgtgggcttcggagag
gcgatttccaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaacaacgaggctggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtggacctg
ctgcagggtgctggcaacagcgcggccggccgcggcgccatcgccgacacctttcgctcc
atctctacccgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
acgctagggctgctgggcaccgaaggccgagagtgcctaaggcgcgggcgggccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgccggagggtcaccaagtacttctgtagccgcgcagagcggccgcgg
gggggcgctgcgcacaaacccgggagaaaaccctaa

DBGET integrated database retrieval system