KEGG   Homo sapiens (human): 7482Help
Entry
7482              CDS       T01001                                 

Gene name
WNT2B, WNT13
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  
wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7482 (WNT2B)
   04390 Hippo signaling pathway
    7482 (WNT2B)
   04150 mTOR signaling pathway
    7482 (WNT2B)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7482 (WNT2B)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7482 (WNT2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7482 (WNT2B)
   05205 Proteoglycans in cancer
    7482 (WNT2B)
   05217 Basal cell carcinoma
    7482 (WNT2B)
   05224 Breast cancer
    7482 (WNT2B)
  Infectious diseases
   05166 HTLV-I infection
    7482 (WNT2B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens (General comment) Effective diffusion, tissue differentiation, development
   7482 (WNT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q93097(Tbio)
UniProt: 
Position
1p13.2
AA seq 391 aa AA seqDB search
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtccctgtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgcgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactacggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcgacgctatgatggggctgtgcaggtgatggccacccaagat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggacgtccatacttgcaaa
gcccccaagaaggcagagtggctggaccaaacctga

DBGET integrated database retrieval system