KEGG   Homo sapiens (human): 7483Help
Entry
7483              CDS       T01001                                 

Gene name
WNT9A, WNT14
Definition
wingless-type MMTV integration site family, member 9A
Orthology
K01064  
wingless-type MMTV integration site family, member 9
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7483 (WNT9A)
   04340 Hedgehog signaling pathway
    7483 (WNT9A)
   04390 Hippo signaling pathway
    7483 (WNT9A)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7483 (WNT9A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7483 (WNT9A)
   05205 Proteoglycans in cancer
    7483 (WNT9A)
   05217 Basal cell carcinoma
    7483 (WNT9A)
  Infectious diseases
   05166 HTLV-I infection
    7483 (WNT9A)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7483 (WNT9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q42
AA seq 365 aa AA seqDB search
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgggtccccgctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctgacgggcagcgagcccctgacc
atcctcccgctgaccctggagccagaggcggctgcccaggcgcactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggcgtggcagag
acgctggtggaggccgtgagcatgagtgcgctcgagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagactgccttcctctatgccatctcctcggctggcctgacgcacgcactggccaaggcg
tgcagcgcgggccgcatggagcgctgtacctgcgatgaggcacccgacctggagaaccgt
gaggcctggcagtgggggggctgcggagacaaccttaagtacagcagcaagttcgtcaag
gaattcctgggcagacggtcaagcaaggatctgcgagcccgtgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacctgcaagtgccacggcgtg
tcaggctcatgcacggtgcggacctgctggcggcagttggcgcctttccatgaggtgggc
aagcatctgaagcacaagtatgagacggcactcaaggtgggcagcaccaccaatgaagct
gccggcgaggcaggtgccatctccccaccacggggccgtgcctcgggggcaggtggcagc
gacccgctgccccgcactccagagctggtgcacctggatgactcgcctagcttctgcctg
gctggccgcttctccccgggcaccgctggccgtaggtgccaccgtgagaagaactgcgag
agcatctgctgtggccgcggccataacacacagagccgggtggtgacaaggccctgccag
tgccaggtgcgttggtgctgctatgtggagtgcaggcagtgcacgcagcgtgaggaggtc
tacacctgcaagggctga

DBGET integrated database retrieval system