KEGG   Homo sapiens (human): 7484Help
Entry
7484              CDS       T01001                                 

Gene name
WNT9B, WNT14B, WNT15
Definition
wingless-type MMTV integration site family, member 9B
Orthology
K01064  
wingless-type MMTV integration site family, member 9
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7484 (WNT9B)
   04340 Hedgehog signaling pathway
    7484 (WNT9B)
   04390 Hippo signaling pathway
    7484 (WNT9B)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    7484 (WNT9B)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7484 (WNT9B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7484 (WNT9B)
   05205 Proteoglycans in cancer
    7484 (WNT9B)
   05217 Basal cell carcinoma
    7484 (WNT9B)
  Infectious diseases
   05166 HTLV-I infection
    7484 (WNT9B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  7484 (WNT9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 357 aa AA seqDB search
MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgggctctgcctgctggcgctgcccgccgcc
gccgcctcctacttcggcctgaccgggcgggaagtcctgacgcccttcccaggattgggc
actgcggcagccccggcacagggcggggcccacctgaagcagtgtgacctgctgaagctg
tcccggcggcagaagcagctctgccggagggagcccggcctggctgagaccctgagggat
gctgcgcacctcggcctgcttgagtgccagtttcagttccggcatgagcgctggaactgt
agcctggagggcaggatgggcctgctcaagagaggcttcaaagagacagctttcctgtac
gcggtgtcctctgccgccctcacccacaccctggcccgggcctgcagcgctgggcgcatg
gagcgctgcacctgtgatgactctccggggctggagagccggcaggcctggcagtggggc
gtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctggggtccaag
agaggaaacaaggacctgcgggcacgggcagacgcccacaatacccacgtgggcatcaag
gctgtgaagagtggcctcaggaccacgtgtaagtgccatggcgtatcaggctcctgtgcc
gtgcgcacctgctggaagcagctctccccgttccgtgagacgggccaggtgctgaaactg
cgctatgactcggctgtcaaggtgtccagtgccaccaatgaggccttgggccgcctagag
ctgtgggcccctgccaggcagggcagcctcaccaaaggcctggccccaaggtctggggac
ctggtgtacatggaggactcacccagcttctgccggcccagcaagtactcacctggcaca
gcaggtagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcggggctat
gacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgctac
gtggagtgccagcaatgtgtgcaggaggagcttgtgtacacctgcaagcactag

DBGET integrated database retrieval system