KEGG   Homo sapiens (human): 7494Help
Entry
7494              CDS       T01001                                 

Gene name
XBP1, TREB5, XBP-1, XBP2
Definition
X-box binding protein 1
Orthology
K09027  
X box-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Non-alcoholic fatty liver disease (NAFLD)
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7494 (XBP1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7494 (XBP1)
  Infectious diseases
   05166 HTLV-I infection
    7494 (XBP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    7494 (XBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.1; 22q12
AA seq 376 aa AA seqDB search
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAGAGPVVTPPEHLPM
DSGGIDSSDSESDILLGILDNLDPVMFFKCPSPEPASLEELPEVYPEGPSSLPASLSLSV
GTSSAKLEAINELIRFDHIYTKPLVLEIPSETESQANVVVKIEEAPLSPSENDHPEFIVS
VKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCGYGGSLSPFSDMSSLLGVNHS
WEDTFANELFPQLISV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtggcagccgcgccgaacccggccgacgggacccctaaagttctgcttctg
tcggggcagcccgcctccgccgccggagccccggccggccaggccctgccgctcatggtg
ccagcccagagaggggccagcccggaggcagcgagcggggggctgccccaggcgcgcaag
cgacagcgcctcacgcacctgagccccgaggagaaggcgctgaggaggaaactgaaaaac
agagtagcagctcagactgccagagatcgaaagaaggctcgaatgagtgagctggaacag
caagtggtagatttagaagaagagaaccaaaaacttttgctagaaaatcagcttttacga
gagaaaactcatggccttgtagttgagaaccaggagttaagacagcgcttggggatggat
gccctggttgctgaagaggaggcggaagccaaggggaatgaagtgaggccagtggccggg
tctgctgagtccgcagcaggtgcaggcccagttgtcacccctccagaacatctccccatg
gattctggcggtattgactcttcagattcagagtctgatatcctgttgggcattctggac
aacttggacccagtcatgttcttcaaatgcccttccccagagcctgccagcctggaggag
ctcccagaggtctacccagaaggacccagttccttaccagcctccctttctctgtcagtg
gggacgtcatcagccaagctggaagccattaatgaactaattcgttttgaccacatatat
accaagcccctagtcttagagataccctctgagacagagagccaagctaatgtggtagtg
aaaatcgaggaagcacctctcagcccctcagagaatgatcaccctgaattcattgtctca
gtgaaggaagaacctgtagaagatgacctcgttccggagctgggtatctcaaatctgctt
tcatccagccactgcccaaagccatcttcctgcctactggatgcttacagtgactgtgga
tacgggggttccctttccccattcagtgacatgtcctctctgcttggtgtaaaccattct
tgggaggacacttttgccaatgaactctttccccagctgattagtgtctaa

DBGET integrated database retrieval system