KEGG   Homo sapiens (human): 7498Help
Entry
7498              CDS       T01001                                 

Gene name
XDH, XO, XOR
Definition
(RefSeq) xanthine dehydrogenase (EC:1.17.1.4 1.17.3.2)
  KO
K00106  
xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Peroxisome
Disease
H00192  
Xanthinuria
Drug target
Allopurinol (DG00779): 
Febuxostat: 
Oxypurinol: 
Topiroxostat: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    7498 (XDH)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    7498 (XDH)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7498 (XDH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    7498 (XDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     7498 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     7498 (XDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7498 (XDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p23.1
AA seq 1333 aa AA seqDB search
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagacaaattggttttctttgtgaatggcagaaaggtggtggagaaaaatgca
gatccagagacaacccttttggcctacctgagaagaaagttggggctgagtggaaccaag
ctcggctgtggagaggggggctgcggggcttgcacagtgatgctctccaagtatgatcgt
ctgcagaacaagatcgtccacttttctgccaatgcctgcctggcccccatctgctccttg
caccatgttgcagtgacaactgtggaaggaataggaagcaccaagacgaggctgcatcct
gtgcaggagagaattgccaaaagccacggctcccagtgcgggttctgcacccctggcatc
gtcatgagtatgtacacactgctccggaatcagcccgagcccaccatggaggagattgag
aatgccttccaaggaaatctgtgccgctgcacaggctacagacccatcctccagggcttc
cggacctttgccagggatggtggatgctgtggaggagatgggaataatccaaattgctgc
atgaaccagaagaaagaccactcagtcagcctctcgccatctttattcaaaccagaggag
ttcacgcccctggatccaacccaggagcccatttttcccccagagttgctgaggctgaaa
gacactcctcggaagcagctgcgatttgaaggggagcgtgtgacgtggatacaggcctca
accctcaaggagctgctggacctcaaggctcagcaccctgacgccaagctggtcgtgggg
aacacggagattggcattgagatgaagttcaagaatatgctgtttcctatgattgtctgc
ccagcctggatccctgagctgaattcggtagaacatggacccgacggtatctcctttgga
gctgcttgccccctgagcattgtggaaaaaaccctggtggatgctgttgctaagcttcct
gcccaaaagacagaggtgttcagaggggtcctggagcagctgcgctggtttgctgggaag
caagtcaagtctgtggcgtccgttggagggaacatcatcactgccagccccatctccgac
ctcaaccccgtgttcatggccagtggggccaagctgacacttgtgtccagaggcaccagg
agaactgtccagatggaccacaccttcttccctggctacagaaagaccctgctgagcccg
gaggagatactgctctccatagagatcccctacagcagggagggggagtatttctcagca
ttcaagcaggcctcccggagagaagatgacattgccaaggtaaccagtggcatgagagtt
ttattcaagccaggaaccacagaggtacaggagctggccctttgctatggtggaatggcc
aacagaaccatctcagccctcaagaccactcagaggcagctttccaagctctggaaggag
gagctgctgcaggacgtgtgtgcaggactggcagaggagctgcatctgcctcccgatgcc
cctggtggcatggtggacttccggtgcaccctcaccctcagcttcttcttcaagttctac
ctgacagtccttcagaagctgggccaagagaacctggaagacaagtgtggtaaactggac
cccactttcgccagtgcaactttactgtttcagaaagaccccccagccgatgtccagctc
ttccaagaggtgcccaagggtcagtctgaggaggacatggtgggccggcccctgccccac
ctggcagcggacatgcaggcctctggtgaggccgtgtactgtgacgacattcctcgctac
gagaatgagctgtctctccggctggtcaccagcacccgggcccacgccaagatcaagtcc
atagatacatcagaagctaagaaggttccagggtttgtttgtttcatttccgctgatgat
gttcctgggagtaacataactggaatttgtaatgatgagacagtctttgcgaaggataag
gttacttgtgttgggcatatcattggtgctgtggttgctgacaccccggaacacacacag
agagctgcccaaggggtgaaaatcacctatgaagaactaccagccattatcacaattgag
gatgctataaagaacaactccttttatggacctgagctgaagatcgagaaaggggaccta
aagaaggggttttccgaagcagataatgttgtgtcaggggagatatacatcggtggccaa
gagcacttctacctggagactcactgcaccattgctgttccaaaaggcgaggcaggggag
atggagctctttgtgtctacacagaacaccatgaagacccagagctttgttgcaaaaatg
ttgggggttccagcaaaccggattgtggttcgagtgaagagaatgggaggaggctttgga
ggcaaggagacccggagcactgtggtgtccacggcagtggccctggctgcatataagacc
ggccgccctgtgcgatgcatgctggaccgtgatgaggacatgctgataactggtggcaga
catcccttcctggccagatacaaggttggcttcatgaagactgggacagttgtggctctt
gaggtggaccacttcagcaatgtggggaacacccaggatctctctcagagtattatggaa
cgagctttattccacatggacaactgctataaaatccccaacatccggggcactgggcgg
ctgtgcaaaaccaaccttccctccaacacggccttccggggctttggggggccccagggg
atgctcattgccgagtgctggatgagtgaagttgcagtgacctgtgggatgcctgcagag
gaggtgcggagaaaaaacctgtacaaagaaggggacctgacacacttcaaccagaagctt
gagggtttcaccttgcccagatgctgggaagaatgcctagcaagctctcagtatcatgct
cggaagagtgaggttgacaagttcaacaaggagaattgttggaaaaagagaggattgtgc
ataattcccaccaagtttggaataagctttacagttccttttctgaatcaggcaggagcc
ctacttcatgtgtacacagatggctctgtgctgctgacccacggggggactgagatgggc
caaggccttcataccaaaatggtccaggtggccagtagagctctgaaaatccccacctct
aagatttatatcagcgagacaagcactaacactgtgcccaacacctctcccacggctgcc
tctgtcagcgctgacctcaatggacaggccgtctatgcggcttgtcagaccatcttgaaa
aggctggaaccctacaagaagaagaatcccagtggctcctgggaagactgggtcacagct
gcctacatggacacagtgagcttgtctgccactgggttttatagaacacccaatctgggc
tacagctttgagactaactcagggaaccccttccactacttcagctatggggtggcttgc
tctgaagtagaaatcgactgcctaacaggagatcataagaacctccgcacagatattgtc
atggatgttggctccagtctaaaccctgccattgatattggacaggtggaaggggcattt
gtccagggccttggcctcttcaccctagaggagctacactattcccccgaggggagcctg
cacacccgtggccctagcacctacaagatcccggcatttggcagcatccccattgagttc
agggtgtccctgctccgcgactgccccaacaagaaggccatctatgcatcgaaggctgtt
ggagagccgcccctcttcctggctgcttctatcttctttgccatcaaagatgccatccgt
gcagctcgagctcagcacacaggtaataacgtgaaggaactcttccggctagacagccct
gccaccccggagaagatccgcaatgcctgcgtggacaagttcaccaccctgtgtgtcact
ggtgtcccagaaaactgcaaaccctggtctgtgagggtctaa

DBGET integrated database retrieval system