KEGG   Homo sapiens (human): 7508Help
Entry
7508              CDS       T01001                                 

Gene name
XPC, RAD4, XP3, XPCC, p125
Definition
(RefSeq) XPC complex subunit, DNA damage recognition and repair factor
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    7508 (XPC)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      7508 (XPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BHD_3 Rad4 BHD_1 BHD_2 zf-B_box
Motif
Other DBs
NCBI-GeneID: 7508
NCBI-ProteinID: NP_004619
OMIM: 613208
HGNC: 12816
Ensembl: ENSG00000154767
Vega: OTTHUMG00000155526
Pharos: Q01831(Tbio)
UniProt: Q01831 X5DRB1
Structure
PDB: 

Jmol
Position
3p25.1
AA seq 940 aa AA seqDB search
MARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGC
SHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNE
DSNEEEEESENDWEEVEELSEPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSE
KIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLANGFYRNNICSQPDLHAIGLSIIPAR
FTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQTTLERRFAIYSARDDEELVH
IFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETSSQVLENHTKP
KTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGR
ERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGS
KSASRTHRGSHRKDPSLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEE
KWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDA
EWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIY
PETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLA
EPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLH
RVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKK
EKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARIL
AASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggctcggaaacgcgcggccggcggggagccgcggggacgcgaactgcgcagccagaaa
tccaaggccaagagcaaggcccggcgtgaggaggaggaggaggatgcctttgaagatgag
aaacccccaaagaagagccttctctccaaagtttcacaaggaaagaggaaaagaggctgc
agtcatcctgggggttcagcagatggtccagcaaaaaagaaagtggccaaggtgactgtt
aaatctgaaaacctcaaggttataaaggatgaagccctcagcgatggggatgacctcagg
gactttccaagtgacctcaagaaggcacaccatctgaagagaggggctaccatgaatgaa
gacagcaatgaagaagaggaagaaagtgaaaatgattgggaagaggttgaagaacttagt
gagcctgtgctgggtgacgtgagagaaagtacagccttctctcgatctcttctgcctgtg
aagccagtggagatagagattgaaacgccagagcaggcgaagacaagagaaagaagtgaa
aagataaaactggagtttgagacatatcttcggagggcgatgaaacgtttcaataaaggg
gtccatgaggacacacacaaggttcaccttctctgcctgctagcaaatggcttctatcga
aataacatctgcagccagccagatctgcatgctattggcctgtccatcatcccagcccgc
tttaccagagtgctgcctcgagatgtggacacctactacctctcaaacctggtgaagtgg
ttcattggaacatttacagttaatgcagaactttcagccagtgaacaagataacctgcag
actacattggaaaggagatttgctatttactctgctcgagatgatgaggaattggtccat
atattcttactgattctccgggctctgcagctcttgacccggctggtattgtctctacag
ccaattcctctgaagtcagcaacagcaaagggaaagaaaccttccaaggaaagattgact
gcggatccaggaggctcctcagaaacttccagccaagttctagaaaaccacaccaaacca
aagaccagcaaaggaaccaaacaagaggaaacctttgctaagggcacctgcaggccaagt
gccaaagggaagaggaacaagggaggcagaaagaaacggagcaagccctcctccagcgag
gaagatgagggcccaggagacaagcaggagaaggcaacccagcgacgtccgcatggccgg
gagcggcgggtggcctccagggtgtcttataaagaggagagtgggagtgatgaggctggc
agcggctctgattttgagctctccagtggagaagcctctgatccctctgatgaggattcc
gaacctggccctccaaagcagaggaaagcccccgctcctcagaggacaaaggctgggtcc
aagagtgcctccaggacccatcgtgggagccatcgtaaggacccaagcttgccagcggca
tcctcaagctcttcaagcagtaaaagaggcaagaaaatgtgcagcgatggtgagaaggca
gaaaaaagaagcatagctggtatagaccagtggctagaggtgttctgtgagcaggaggaa
aagtgggtatgtgtagactgtgtgcacggtgtggtgggccagcctctgacctgttacaag
tacgccaccaagcccatgacctatgtggtgggcattgacagtgacggctgggtccgagat
gtcacacagaggtacgacccagtctggatgacagtgacccgcaagtgccgggttgatgct
gagtggtgggccgagaccttgagaccataccagagcccatttatggacagggagaagaaa
gaagacttggagtttcaggcaaaacacatggaccagcctttgcccactgccattggctta
tataagaaccaccctctgtatgccctgaagcggcatctcctgaaatatgaggccatctat
cccgagacagctgccatccttgggtattgtcgtggagaagcggtctactccagggattgt
gtgcacactctgcattccagggacacgtggctgaagaaagcaagagtggtgaggcttgga
gaagtaccctacaagatggtgaaaggcttttctaaccgtgctcggaaagcccgacttgct
gagccccagctgcgggaagaaaatgacctgggcctgtttggctactggcagacagaggag
tatcagcccccagtggccgtggacgggaaggtgccccggaacgagtttgggaatgtgtac
ctcttcctgcccagcatgatgcctattggctgtgtccagctgaacctgcccaatctacac
cgcgtggcccgcaagctggacatcgactgtgtccaggccatcactggctttgatttccat
ggcggctactcccatcccgtgactgatggatacatcgtctgcgaggaattcaaagacgtg
ctcctgactgcctgggaaaatgagcaggcagtcattgaaaggaaggagaaggagaaaaag
gagaagcgggctctagggaactggaagttgctggccaaaggtctgctcatcagggagagg
ctgaagcgtcgctacgggcccaagagtgaggcagcagctccccacacagatgcaggaggt
ggactctcttctgatgaagaggaggggaccagctctcaagcagaagcggccaggatactg
gctgcctcctggcctcaaaaccgagaagatgaagaaaagcagaagctgaagggtgggccc
aagaagaccaaaagggaaaagaaagcagcagcttcccacctgttcccatttgagcagctg
tga

DBGET integrated database retrieval system