KEGG   Homo sapiens (human): 7512Help
Entry
7512              CDS       T01001                                 

Gene name
XPNPEP2, AEACEI, APP2
Definition
X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound (EC:3.4.11.9)
Orthology
K14208  
Xaa-Pro aminopeptidase 2 [EC:3.4.11.9]
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq25
AA seq 674 aa AA seqDB search
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQ
MQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQ
AERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQL
VSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
ALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCV
QIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSK
EQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETIS
ASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYT
RVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQ
SNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNL
IDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWAS
VLVVSTLAILGWSV
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggctcactggggctgctgcccctggctggtcctcctctgtgcttgtgcctgg
ggccacacaaagccagtggaccttggagggcaggatgtgagaaactgttccaccaacccc
ccttaccttccagttactgtggtcaataccacaatgtcactcacagccctccgccagcag
atgcagacccagaatctctcagcctacatcatcccaggcacagatgctcacatgaacgag
tacatcggccaacatgacgagaggcgtgcgtggattacaggctttacagggtctgcagga
actgcagtggtgactatgaagaaagcagctgtctggaccgacagtcgctactggactcag
gctgagcggcagatggactgcaactgggagctccataaggaagttggcaccactcctatt
gtcacctggctcctcaccgagattcctgctggagggcgtgtgggttttgaccccttcctc
ttgtccattgacacctgggagagttatgatctggccctccaaggctctaacagacagctg
gtgtccatcacaaccaatcttgtggacctggtatggggatcagagaggccaccggttcca
aatcaacccatttatgccctgcaggaggcattcacagggagcacttggcaggagaaagta
tctggcgtccgaagccagatgcagaagcatcaaaaggtcccgactgccgtccttctgtcg
gcgcttgaggagacggcctggctcttcaaccttcgagccagtgacatcccctataacccc
ttcttctattcctacacgctgctcacagactcttctattaggttgtttgcaaacaagagt
cgctttagctccgaaaccttgagctatctgaactccagttgcacaggccccatgtgtgtg
caaatcgaggattacagccaagttcgtgacagcatccaggcctactcattgggagatgtg
aggatctggattgggaccagctataccatgtatgggatctatgaaatgatacccaaggag
aaactcgtgacagacacctactccccagtgatgatgaccaaggcagtgaagaacagcaag
gagcaggccctcctcaaggccagccacgtgcgggacgctgtggctgtgatccggtacttg
gtctggctggagaagaacgtgcccaaaggcacagtggatgagttctcgggggcagagatc
gtggacaagttccgaggagaagaacagttctcctccggacccagttttgaaaccatctct
gctagtggtctgaatgctgccctggcccactacagcccgaccaaggagctgaaccgcaag
ctgtcctcagatgagatgtacctgctggactctggggggcagtactgggacgggaccaca
gacatcaccagaacagtccactggggcaccccctctgccttccagaaggaggcatacacc
cgtgtgctgataggaaatattgacctgtccaggctcatctttcccgctgctacatcaggg
cgaatggtggaggcctttgcccgcagagccttgtgggatgctggtctcaattatggtcat
gggacaggccacggcattggcaacttcctgtgtgtgcatgagtggccagtgggattccag
tccaacaacatcgctatggccaagggcatgttcacttccattgaacctggttactataag
gatggagaatttgggatccgtctcgaagatgtggctctcgtggtagaagcaaagaccaag
tacccagggagctacctgacctttgaagtggtatcatttgtgccctatgaccggaacctc
atcgatgtcagcctgctgtctcccgagcatctccagtacctgaatcgctactaccagacc
atccgggagaaggtgggtccagagctgcagaggcgccagctactagaggagttcgagtgg
cttcaacagcacacagagcccctggccgccagggccccagacaccgcctcctgggcctct
gtgttagtggtctccacccttgccatccttggctggagtgtctag

DBGET integrated database retrieval system