KEGG   Homo sapiens (human): 7514Help
Entry
7514              CDS       T01001                                 

Gene name
XPO1, CRM1, emb, exp1
Definition
exportin 1 (CRM1 homolog, yeast)
Orthology
K14290  
exportin-1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p15
AA seq 1071 aa AA seqDB search
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgcttgatttcagc
caaaaactggatatcaacttattagataatgtggtgaattgcttataccatggagaagga
gcccagcaaagaatggctcaagaagtactgacacatttaaaggagcatcctgatgcttgg
acaagagtcgacacaattttggaattttctcagaatatgaatacgaaatactatggacta
caaattttggaaaatgtgataaaaacaaggtggaagattcttccaaggaaccagtgcgaa
ggaataaaaaaatacgttgttggcctcattatcaagacgtcatctgacccaacttgtgta
gagaaagaaaaggtgtatatcggaaaattaaatatgatccttgttcagatactgaaacaa
gaatggcccaaacattggccaacttttatcagtgatattgttggagcaagtaggaccagc
gaaagtctctgtcaaaataatatggtgattcttaaactcttgagtgaagaagtatttgat
ttctctagtggacagataacccaagtcaaatctaagcatttaaaagacagcatgtgcaat
gaattctcacagatatttcaactgtgtcagtttgtaatggaaaattctcaaaatgctcca
cttgtacatgcaaccttggaaacattgctcagatttctgaactggattcccctgggatat
atttttgagaccaaattaatcagcacattgatttataagttcctgaatgttccaatgttt
cgaaatgtctctctgaagtgcctcactgagattgctggtgtgagtgtaagccaatatgaa
gaacaatttgtaacactatttactctgacaatgatgcaactaaagcagatgcttccttta
aataccaatattcgacttgcgtactcaaatggaaaagatgatgaacagaacttcattcaa
aatctcagtttgtttctctgcacctttcttaaggaacatgatcaacttatagaaaaaaga
ttaaatctcagggaaactcttatggaggcccttcattatatgttgttggtatctgaagta
gaagaaactgaaatctttaaaatttgtcttgaatactggaatcatttggctgctgaactc
tatagagagagtccattctctacatctgcctctccgttgctttctggaagtcaacatttt
gatgttcctcccaggagacagctatatttgcccatgttattcaaggtccgtttattaatg
gttagtcgaatggctaaaccagaggaagtattggttgtagagaatgatcaaggagaagtt
gtgagagaattcatgaaggatacagattccataaatttgtataagaatatgagggaaaca
ttggtttatcttactcatctggattatgtagatacagaaagaataatgacagagaagctt
cacaatcaagtgaatggtacagagtggtcatggaaaaatttgaatacattgtgttgggca
ataggctccattagtggagcaatgcatgaagaggacgaaaaacgatttcttgttactgtt
ataaaggatctattaggattatgtgaacagaaaagaggcaaagataataaagctattatt
gcatcaaatatcatgtacatagtaggtcaatacccacgttttttgagagctcactggaaa
tttctgaagactgtagttaacaagctgttcgaattcatgcatgagacccatgatggagtc
caggatatggcttgtgatactttcattaaaatagcccaaaaatgccgcaggcatttcgtt
caggttcaggttggagaagtgatgccatttattgatgaaattttgaacaacattaacact
attatttgtgatcttcagcctcaacaggttcatacgttttatgaagctgtggggtacatg
attggtgcacaaacagatcaaacagtacaagaacacttgatagaaaagtacatgttactc
cctaatcaagtgtgggatagtataatccagcaggcaaccaaaaatgtggatatactgaaa
gatcctgaaacagtcaagcagcttggtagcattttgaaaacaaatgtgagagcctgcaaa
gctgttggacacccctttgtaattcagcttggaagaatttatttagatatgcttaatgta
tacaagtgcctcagtgaaaatatttctgcagctatccaagctaatggtgaaatggttaca
aagcaaccattgattagaagtatgcgaactgtaaaaagggaaactttaaagttaatatct
ggttgggtgagccgatccaatgatccacagatggtcgctgaaaattttgttccccctctg
ttggatgcagttctcattgattatcagagaaatgtcccagctgctagagaaccagaagtg
cttagtactatggccataattgtcaacaagttagggggacatataacagctgaaatacct
caaatatttgatgctgtttttgaatgcacattgaatatgataaataaggactttgaagaa
tatcctgaacatagaacgaactttttcttactacttcaggctgtcaattctcattgtttc
ccagcattccttgctattccacctacacagtttaaacttgttttggattccatcatttgg
gctttcaaacatactatgaggaatgtcgcagatacgggcttacagatactttttacactc
ttacaaaatgttgcacaagaagaagctgcagctcagagtttttatcaaacttatttttgt
gatattctccagcatatcttttctgttgtgacagacacttcacatactgctggtttaaca
atgcatgcatcaattcttgcatatatgtttaatttggttgaagaaggaaaaataagtaca
tcattaaatcctggaaatccagttaacaaccaaatctttcttcaggaatatgtggctaat
ctccttaagtcggccttccctcacctacaagatgctcaagtaaagctctttgtgacaggg
cttttcagcttaaatcaagatattcctgctttcaaggaacatttaagagatttcctagtt
caaataaaggaatttgcaggtgaagacacttctgatttgtttttggaagagagagaaata
gccctacggcaggctgatgaagagaaacataaacgtcaaatgtctgtccctggcatcttt
aatccacatgagattccagaagaaatgtgtgattaa

DBGET integrated database retrieval system