KEGG   Homo sapiens (human): 7514Help
Entry
7514              CDS       T01001                                 

Gene name
XPO1, CRM1, emb, exp1
Definition
exportin 1
Orthology
K14290  
exportin-1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    7514 (XPO1)
   03008 Ribosome biogenesis in eukaryotes
    7514 (XPO1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    7514 (XPO1)
   05164 Influenza A
    7514 (XPO1)
   05169 Epstein-Barr virus infection
    7514 (XPO1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA transport factors
   tRNA export factors
    7514 (XPO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p15
AA seq 1071 aa AA seqDB search
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgcttgatttcagc
caaaaactggatatcaacttattagataatgtggtgaattgcttataccatggagaagga
gcccagcaaagaatggctcaagaagtactgacacatttaaaggagcatcctgatgcttgg
acaagagtcgacacaattttggaattttctcagaatatgaatacgaaatactatggacta
caaattttggaaaatgtgataaaaacaaggtggaagattcttccaaggaaccagtgcgaa
ggaataaaaaaatacgttgttggcctcattatcaagacgtcatctgacccaacttgtgta
gagaaagaaaaggtgtatatcggaaaattaaatatgatccttgttcagatactgaaacaa
gaatggcccaaacattggccaacttttatcagtgatattgttggagcaagtaggaccagc
gaaagtctctgtcaaaataatatggtgattcttaaactcttgagtgaagaagtatttgat
ttctctagtggacagataacccaagtcaaatctaagcatttaaaagacagcatgtgcaat
gaattctcacagatatttcaactgtgtcagtttgtaatggaaaattctcaaaatgctcca
cttgtacatgcaaccttggaaacattgctcagatttctgaactggattcccctgggatat
atttttgagaccaaattaatcagcacattgatttataagttcctgaatgttccaatgttt
cgaaatgtctctctgaagtgcctcactgagattgctggtgtgagtgtaagccaatatgaa
gaacaatttgtaacactatttactctgacaatgatgcaactaaagcagatgcttccttta
aataccaatattcgacttgcgtactcaaatggaaaagatgatgaacagaacttcattcaa
aatctcagtttgtttctctgcacctttcttaaggaacatgatcaacttatagaaaaaaga
ttaaatctcagggaaactcttatggaggcccttcattatatgttgttggtatctgaagta
gaagaaactgaaatctttaaaatttgtcttgaatactggaatcatttggctgctgaactc
tatagagagagtccattctctacatctgcctctccgttgctttctggaagtcaacatttt
gatgttcctcccaggagacagctatatttgcccatgttattcaaggtccgtttattaatg
gttagtcgaatggctaaaccagaggaagtattggttgtagagaatgatcaaggagaagtt
gtgagagaattcatgaaggatacagattccataaatttgtataagaatatgagggaaaca
ttggtttatcttactcatctggattatgtagatacagaaagaataatgacagagaagctt
cacaatcaagtgaatggtacagagtggtcatggaaaaatttgaatacattgtgttgggca
ataggctccattagtggagcaatgcatgaagaggacgaaaaacgatttcttgttactgtt
ataaaggatctattaggattatgtgaacagaaaagaggcaaagataataaagctattatt
gcatcaaatatcatgtacatagtaggtcaatacccacgttttttgagagctcactggaaa
tttctgaagactgtagttaacaagctgttcgaattcatgcatgagacccatgatggagtc
caggatatggcttgtgatactttcattaaaatagcccaaaaatgccgcaggcatttcgtt
caggttcaggttggagaagtgatgccatttattgatgaaattttgaacaacattaacact
attatttgtgatcttcagcctcaacaggttcatacgttttatgaagctgtggggtacatg
attggtgcacaaacagatcaaacagtacaagaacacttgatagaaaagtacatgttactc
cctaatcaagtgtgggatagtataatccagcaggcaaccaaaaatgtggatatactgaaa
gatcctgaaacagtcaagcagcttggtagcattttgaaaacaaatgtgagagcctgcaaa
gctgttggacacccctttgtaattcagcttggaagaatttatttagatatgcttaatgta
tacaagtgcctcagtgaaaatatttctgcagctatccaagctaatggtgaaatggttaca
aagcaaccattgattagaagtatgcgaactgtaaaaagggaaactttaaagttaatatct
ggttgggtgagccgatccaatgatccacagatggtcgctgaaaattttgttccccctctg
ttggatgcagttctcattgattatcagagaaatgtcccagctgctagagaaccagaagtg
cttagtactatggccataattgtcaacaagttagggggacatataacagctgaaatacct
caaatatttgatgctgtttttgaatgcacattgaatatgataaataaggactttgaagaa
tatcctgaacatagaacgaactttttcttactacttcaggctgtcaattctcattgtttc
ccagcattccttgctattccacctacacagtttaaacttgttttggattccatcatttgg
gctttcaaacatactatgaggaatgtcgcagatacgggcttacagatactttttacactc
ttacaaaatgttgcacaagaagaagctgcagctcagagtttttatcaaacttatttttgt
gatattctccagcatatcttttctgttgtgacagacacttcacatactgctggtttaaca
atgcatgcatcaattcttgcatatatgtttaatttggttgaagaaggaaaaataagtaca
tcattaaatcctggaaatccagttaacaaccaaatctttcttcaggaatatgtggctaat
ctccttaagtcggccttccctcacctacaagatgctcaagtaaagctctttgtgacaggg
cttttcagcttaaatcaagatattcctgctttcaaggaacatttaagagatttcctagtt
caaataaaggaatttgcaggtgaagacacttctgatttgtttttggaagagagagaaata
gccctacggcaggctgatgaagagaaacataaacgtcaaatgtctgtccctggcatcttt
aatccacatgagattccagaagaaatgtgtgattaa

DBGET integrated database retrieval system