KEGG   Homo sapiens (human): 7515Help
Entry
7515              CDS       T01001                                 

Gene name
XRCC1, RCC
Definition
X-ray repair complementing defective repair in Chinese hamster cells 1
Orthology
K10803  
DNA-repair protein XRCC1
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    7515 (XRCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 633 aa AA seqDB search
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatccgcctccgccatgtcgtgtcctgcagcagccaggactcgactcactgt
gcagaaaatcttctcaaggcagacacttaccgaaaatggcgggcagccaaggcaggcgag
aagaccatctctgtggtcctacagttggagaaggaggagcagatacacagtgtggacatt
gggaatgatggctcagctttcgtggaggtgctggtgggcagttcagctggaggcgctggg
gagcaagactatgaggtccttctggtcacctcatctttcatgtccccttccgagagccgc
agtggctcaaaccccaaccgcgttcgcatgtttgggcctgacaagctggtccgggcagcc
gccgagaagcgctgggaccgggtcaaaattgtttgcagccagccctacagcaaggactcc
ccctttggcttgagttttgtacggtttcatagccccccagacaaagatgaggcagaggcc
ccgtcccagaaggtgacagtgaccaagcttggccagttccgtgtgaaggaggaggatgag
agcgccaactctctgaggccgggggctctcttcttcagccggatcaacaagacatcccca
gtcacagccagcgacccagcaggacctagctatgcagctgctaccctccaggcttctagt
gctgcctcctcagcctctccagtctccagggccataggcagcacctccaagccccaggag
tctcccaaagggaagaggaagttggatttgaaccaagaagaaaagaagacccccagcaaa
ccaccagcccagctgtcgccatctgttcccaagagacctaaattgccagctccaactcgt
accccagccacagccccagtccctgcccgagcacagggggcagtgacaggcaaaccccga
ggagaaggcaccgagcccagacgaccccgagctggcccagaggagctggggaagatcctt
cagggtgtggtagtggtgctgagtggcttccagaaccccttccgctccgagctgcgagat
aaggccctagagcttggggccaagtatcggccagactggacccgggacagcacgcacctc
atctgtgcctttgccaacacccccaagtacagccaggtcctaggcctgggaggccgcatc
gtgcgtaaggagtgggtgctggactgtcaccgcatgcgtcggcggctgccctcccagagg
tacctcatggcagggccaggttccagcagtgaggaggatgaggcctctcacagcggtggc
agcggagatgaagcccccaagcttcctcagaagcaaccccagaccaaaaccaagcccact
caggcagctggacccagctcaccccagaagcccccaacccctgaagagaccaaagcagcc
tcaccagtgctccaggaagatatagacattgagggggtacagtcagaaggacaggacaat
ggggcggaagattctggggacacagaggatgagctgaggagggtggcagagcagaaggaa
cacagactgccccctggccaggaggagaatggggaagacccgtatgcaggctccacggat
gagaacacggacagtgaggaacaccaggagcctcctgatctgccagtccctgagctccca
gatttcttccagggcaagcacttctttctttacggggagttccctggggacgagcggcgg
aaactcatccgatacgtcacagccttcaatggggagctcgaggactatatgagtgaccgg
gttcagtttgtgatcacagcacaggaatgggatcccagctttgaggaggccctgatggac
aacccctccctggcattcgttcgtccccgatggatctacagttgcaatgagaagcagaag
ttacttcctcaccagctctatggggtggtgccgcaagcctga

DBGET integrated database retrieval system