KEGG   Homo sapiens (human): 7517Help
Entry
7517              CDS       T01001                                 

Gene name
XRCC3, CMM6
Definition
X-ray repair complementing defective repair in Chinese hamster cells 3
Orthology
K10880  
DNA-repair protein XRCC3
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    7517 (XRCC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.3
AA seq 346 aa AA seqDB search
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF
IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatttggatctactggacctgaatcccagaattattgctgcaattaagaaagccaaa
ctgaaatcggtaaaggaggttttacacttttctggaccagacttgaagagactgaccaac
ctctccagccccgaggtctggcacttgctgagaacggcctccttacacttgcggggaagc
agcatccttacagcactgcagctgcaccagcagaaggagcggttccccacgcagcaccag
cgcctgagcctgggctgcccggtgctggacgcgctgctccgcggtggcctgcccctggac
ggcatcactgagctggccggacgcagctcggcagggaagacccagctggcgctgcagctc
tgcctggctgtgcagttcccgcggcagcacggaggcctggaggctggagccgtctacatc
tgcacggaagacgccttcccgcacaagcgcctgcagcagctcatggcccagcagccgcgg
ctgcgcactgacgttccaggagagctgcttcagaagctccgatttggcagccagatcttc
atcgagcacgtggccgatgtggacaccttgttggagtgtgtgaataagaaggtccccgta
ctgctgtctcggggcatggctcgcctggtggtcatcgactcggtggcagccccattccgc
tgtgaatttgacagccaggcctccgcccccagggccaggcatctgcagtccctgggggcc
acgctgcgtgagctgagcagtgccttccagagccctgtgctgtgcatcaaccaggtgaca
gaggccatggaggagcagggcgcagcacacgggccgctggggttctgggacgaacgtgtt
tccccagcccttggcataacctgggctaaccagctcctggtgagactgctggctgaccgg
ctccgcgaggaagaggctgccctcggctgcccagcccggaccctgcgggtgctctctgcc
ccccacctgcccccctcctcctgttcctacacgatcagtgccgaaggggtgcgagggaca
cctgggacccagtcccactga

DBGET integrated database retrieval system