KEGG   Homo sapiens (human): 7518Help
Entry
7518              CDS       T01001                                 

Gene name
XRCC4, SSMED
Definition
(RefSeq) X-ray repair cross complementing 4
  KO
K10886  DNA-repair protein XRCC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    7518 (XRCC4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     7518 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XRCC4 DUF927
Motif
Other DBs
NCBI-GeneID: 7518
NCBI-ProteinID: NP_001304941
OMIM: 194363
HGNC: 12831
Ensembl: ENSG00000152422
Vega: OTTHUMG00000131319
Pharos: Q13426(Tbio)
UniProt: Q13426 Q7Z763 A0A024RAQ8
Structure
PDB: 

Jmol
Position
5q14.2
AA seq 336 aa AA seqDB search
MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQ
TDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSR
PDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaaataagcagaatccaccttgtttctgaacccagtataactcattttcta
caagtatcttgggagaaaacactggaatctggttttgttattacacttactgatggtcat
tcagcatggactgggacagtttctgaatcagagatttcccaagaagctgatgacatggca
atggaaaaagggaaatatgttggtgaactgagaaaagcattgttgtcaggagcaggacca
gctgatgtatacacgtttaatttttctaaagagtcttgttatttcttctttgagaaaaac
ctgaaagatgtctcattcagacttggttccttcaacctagagaaagttgaaaacccagct
gaagtcattagagaacttatttgttattgcttggacaccattgcagaaaatcaagccaaa
aatgagcacctgcagaaagaaaatgaaaggcttctgagagattggaatgatgttcaagga
cgatttgaaaaatgtgtgagtgctaaggaagctttggagactgatctttataagcggttt
attctggtgttgaatgagaagaaaacaaaaatcagaagtttgcataataaattattaaat
gcagctcaagaacgagaaaaggacatcaaacaagaaggggaaactgcaatctgttctgaa
atgactgctgaccgagatccagtctatgatgagagtactgatgaggaaagtgaaaaccaa
actgatctctctgggttggcttcagctgctgtaagtaaagatgattccattatttcaagt
cttgatgtcactgatattgcaccaagtagaaaaaggagacagcgaatgcaaagaaatctt
gggacagaacctaaaatggctcctcaggagaatcagcttcaagaaaaggaaaattctagg
cctgattcttcactacctgagacgtctaaaaaggagcacatctcagctgaaaacatgtct
ttagaaactctgagaaacagcagcccagaagacctctttgatgagatttaa

DBGET integrated database retrieval system