KEGG   Homo sapiens (human): 7518Help
Entry
7518              CDS       T01001                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    7518 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q14.2
AA seq 334 aa AA seqDB search
MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQ
TDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKEKPD
SSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaaataagcagaatccaccttgtttctgaacccagtataactcattttcta
caagtatcttgggagaaaacactggaatctggttttgttattacacttactgatggtcat
tcagcatggactgggacagtttctgaatcagagatttcccaagaagctgatgacatggca
atggaaaaagggaaatatgttggtgaactgagaaaagcattgttgtcaggagcaggacca
gctgatgtatacacgtttaatttttctaaagagtcttgttatttcttctttgagaaaaac
ctgaaagatgtctcattcagacttggttccttcaacctagagaaagttgaaaacccagct
gaagtcattagagaacttatttgttattgcttggacaccattgcagaaaatcaagccaaa
aatgagcacctgcagaaagaaaatgaaaggcttctgagagattggaatgatgttcaagga
cgatttgaaaaatgtgtgagtgctaaggaagctttggagactgatctttataagcggttt
attctggtgttgaatgagaagaaaacaaaaatcagaagtttgcataataaattattaaat
gcagctcaagaacgagaaaaggacatcaaacaagaaggggaaactgcaatctgttctgaa
atgactgctgaccgagatccagtctatgatgagagtactgatgaggaaagtgaaaaccaa
actgatctctctgggttggcttcagctgctgtaagtaaagatgattccattatttcaagt
cttgatgtcactgatattgcaccaagtagaaaaaggagacagcgaatgcaaagaaatctt
gggacagaacctaaaatggctcctcaggagaatcagcttcaagaaaaggaaaagcctgat
tcttcactacctgagacgtctaaaaaggagcacatctcagctgaaaacatgtctttagaa
actctgagaaacagcagcccagaagacctctttgatgagatttaa

DBGET integrated database retrieval system