KEGG   Homo sapiens (human): 7520Help
Entry
7520              CDS       T01001                                 

Gene name
XRCC5, KARP-1, KARP1, KU80, KUB2, Ku86, NFIV
Definition
X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Orthology
K10885  
ATP-dependent DNA helicase 2 subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Module
DNA-PK complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    7520 (XRCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 732 aa AA seqDB search
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFG
TDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQH
ETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGD
GPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDD
DETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQ
VLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLI
EAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRV
LVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLK
ALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFE
EGGDVDDLLDMI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtcggggaataaggcagctgttgtgctgtgtatggacgtgggctttaccatg
agtaactccattcctggtatagaatccccatttgaacaagcaaagaaggtgataaccatg
tttgtacagcgacaggtgtttgctgagaacaaggatgagattgctttagtcctgtttggt
acagatggcactgacaatcccctttctggtggggatcagtatcagaacatcacagtgcac
agacatctgatgctaccagattttgatttgctggaggacattgaaagcaaaatccaacca
ggttctcaacaggctgacttcctggatgcactaatcgtgagcatggatgtgattcaacat
gaaacaataggaaagaagtttgagaagaggcatattgaaatattcactgacctcagcagc
cgattcagcaaaagtcagctggatattataattcatagcttgaagaaatgtgacatctcc
ctgcaattcttcttgcctttctcacttggcaaggaagatggaagtggggacagaggagat
ggcccctttcgcttaggtggccatgggccttcctttccactaaaaggaattaccgaacag
caaaaagaaggtcttgagatagtgaaaatggtgatgatatctttagaaggtgaagatggg
ttggatgaaatttattcattcagtgagagtctgagaaaactgtgcgtcttcaagaaaatt
gagaggcattccattcactggccctgccgactgaccattggctccaatttgtctataagg
attgcagcctataaatcgattctacaggagagagttaaaaagacttggacagttgtggat
gcaaaaaccctaaaaaaagaagatatacaaaaagaaacagtttattgcttaaatgatgat
gatgaaactgaagttttaaaagaggatattattcaagggttccgctatggaagtgatata
gttcctttctctaaagtggatgaggaacaaatgaaatataaatcggaggggaagtgcttc
tctgttttgggattttgtaaatcttctcaggttcagagaagattcttcatgggaaatcaa
gttctaaaggtctttgcagcaagagatgatgaggcagctgcagttgcactttcctccctg
attcatgctttggatgacttagacatggtggccatagttcgatatgcttatgacaaaaga
gctaatcctcaagtcggcgtggcttttcctcatatcaagcataactatgagtgtttagtg
tatgtgcagctgcctttcatggaagacttgcggcaatacatgttttcatccttgaaaaac
agtaagaaatatgctcccaccgaggcacagttgaatgctgttgatgctttgattgactcc
atgagcttggcaaagaaagatgagaagacagacacccttgaagacttgtttccaaccacc
aaaatcccaaatcctcgatttcagagattatttcagtgtctgctgcacagagctttacat
ccccgggagcctctacccccaattcagcagcatatttggaatatgctgaatcctcccgct
gaggtgacaacaaaaagtcagattcctctctctaaaataaagaccctttttcctctgatt
gaagccaagaaaaaggatcaagtgactgctcaggaaattttccaagacaaccatgaagat
ggacctacagctaaaaaattaaagactgagcaagggggagcccacttcagcgtctccagt
ctggctgaaggcagtgtcacctctgttggaagtgtgaatcctgctgaaaacttccgtgtt
ctagtgaaacagaagaaggccagctttgaggaagcgagtaaccagctcataaatcacatc
gaacagtttttggatactaatgaaacaccgtattttatgaagagcatagactgcatccga
gccttccgggaagaagccattaagttttcagaagagcagcgctttaacaacttcctgaaa
gcccttcaagagaaagtggaaattaaacaattaaatcatttctgggaaattgttgtccag
gatggaattactctgatcaccaaagaggaagcctctggaagttctgtcacagctgaggaa
gccaaaaagtttctggcccccaaagacaaaccaagtggagacacagcagctgtatttgaa
gaaggtggtgatgtggacgatttattggacatgatatag

DBGET integrated database retrieval system