KEGG   Homo sapiens (human): 7525Help
Entry
7525              CDS       T01001                                 

Gene name
YES1, HsT441, P61-YES, Yes, c-yes
Definition
(RefSeq) YES proto-oncogene 1, Src family tyrosine kinase
  KO
K05705  
tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    7525 (YES1)
   04530 Tight junction
    7525 (YES1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7525 (YES1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   7525 (YES1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    7525 (YES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.31-p11.21
AA seq 543 aa AA seqDB search
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcattaaaagtaaagaaaacaaaagtccagccattaaatacagacctgaaaat
actccagagcctgtcagtacaagtgtgagccattatggagcagaacccactacagtgtca
ccatgtccgtcatcttcagcaaagggaacagcagttaatttcagcagtctttccatgaca
ccatttggaggatcctcaggggtaacgccttttggaggtgcatcttcctcattttcagtg
gtgccaagttcatatcctgctggtttaacaggtggtgttactatatttgtggccttatat
gattatgaagctagaactacagaagacctttcatttaagaagggtgaaagatttcaaata
attaacaatacggaaggagattggtgggaagcaagatcaatcgctacaggaaagaatggt
tatatcccgagcaattatgtagcgcctgcagattccattcaggcagaagaatggtatttt
ggcaaaatggggagaaaagatgctgaaagattacttttgaatcctggaaatcaacgaggt
attttcttagtaagagagagtgaaacaactaaaggtgcttattccctttctattcgtgat
tgggatgagataaggggtgacaatgtgaaacactacaaaattaggaaacttgacaatggt
ggatactatatcacaaccagagcacaatttgatactctgcagaaattggtgaaacactac
acagaacatgctgatggtttatgccacaagttgacaactgtgtgtccaactgtgaaacct
cagactcaaggtctagcaaaagatgcttgggaaatccctcgagaatctttgcgactagag
gttaaactaggacaaggatgtttcggcgaagtgtggatgggaacatggaatggaaccacg
aaagtagcaatcaaaacactaaaaccaggtacaatgatgccagaagctttccttcaagaa
gctcagataatgaaaaaattaagacatgataaacttgttccactatatgctgttgtttct
gaagaaccaatttacattgtcactgaatttatgtcaaaaggaagcttattagatttcctt
aaggaaggagatggaaagtatttgaagcttccacagctggttgatatggctgctcagatt
gctgatggtatggcatatattgaaagaatgaactatattcaccgagatcttcgggctgct
aatattcttgtaggagaaaatcttgtgtgcaaaatagcagactttggtttagcaaggtta
attgaagacaatgaatacacagcaagacaaggtgcaaaatttccaatcaaatggacagct
cctgaagctgcactgtatggtcggtttacaataaagtctgatgtctggtcatttggaatt
ctgcaaacagaactagtaacaaagggccgagtgccatatccaggtatggtgaaccgtgaa
gtactagaacaagtggagcgaggatacaggatgccgtgccctcagggctgtccagaatcc
ctccatgaattgatgaatctgtgttggaagaaggaccctgatgaaagaccaacatttgaa
tatattcagtccttcttggaagactacttcactgctacagagccacagtaccagccagga
gaaaatttataa

DBGET integrated database retrieval system