KEGG   Homo sapiens (human): 7546Help
Entry
7546              CDS       T01001                                 

Gene name
ZIC2, HPE5
Definition
(RefSeq) Zic family member 2
  KO
K06235  
zinc finger protein ZIC 2
Organism
hsa  Homo sapiens (human)
Disease
H00267  
Holoprosencephaly (HPE)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7546 (ZIC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95409(Tbio)
UniProt: 
Position
13q32.3
AA seq 532 aa AA seqDB search
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggacgcgggtccgcagttcccggccatcggggtgggcagcttcgcgcgccac
catcaccactccgccgcggcggcggcggcggctgccgccgagatgcaggaccgtgaactg
agcctggcggcggcgcagaacggcttcgttgactccgccgccgcgcacatgggagccttc
aagctcaacccgggcgcgcacgagctgtccccgggccagagctcggcgttcacgtcgcag
ggccccggcgcctaccccggctccgctgcggctgccgctgcggccgcagcgctcgggccc
cacgccgcgcacgttggctcctactctgggccgcccttcaactccacccgggacttcctg
ttccgcagccgcggcttcggggactcggcgccgggcggcgggcagcacgggctgttcggg
ccgggcgcgggcggcctgcaccacgcgcactcggacgcgcagggccacctcctcttcccg
ggcctgccagagcagcacgggccgcacggctcgcagaatgtgctcaacgggcagatgcgc
ctcgggctgcccggcgaggtgttcgggcgctcggagcaataccgccaggtggccagcccg
cggaccgacccctactcggcggcgcaactccacaaccagtacggccccatgaatatgaac
atgggtatgaacatggcagcagccgcggcccaccaccaccaccaccaccaccaccacccc
ggtgcctttttccgctatatgcggcagcagtgcatcaagcaggagctaatctgcaagtgg
atcgaccccgagcaactgagcaatcccaagaagagctgcaacaaaactttcagcaccatg
cacgagctggtgacacacgtctcggtggagcacgtcggcggcccggagcagagcaaccac
gtctgcttctgggaggagtgtccgcgcgagggcaagcccttcaaggccaaatacaaactg
gtcaaccacatccgcgtgcacacaggcgagaaacccttcccctgccccttcccgggctgt
ggcaaagtcttcgcgcgctccgagaacctcaagatccacaaaaggacccacacaggggag
aagccgttccagtgtgagtttgagggctgcgaccggcgcttcgccaacagcagcgacagg
aagaagcacatgcacgtccacacctccgataagccctatctctgcaagatgtgcgacaag
tcctacacgcaccccagctcgctgcggaagcacatgaaggtccatgagtcctccccgcag
ggctctgaatcctccccggccgccagctccggctatgagtcgtccacgcccccggggctg
gtgtcccccagcgccgagccccagagcagctccaacctgtccccagcggcggcggcagcg
gcggcggcggctgcggcggcggcggccgcggtgtccgcggtgcaccggggcggaggctcg
ggcagtggcggcgcgggaggcggctcaggcggcggcagcggcagtggcgggggcggcggc
ggggcgggcggcgggggcggcggcagctctggcgggggcagcgggacagccgggggtcac
agcggcctctcctccaacttcaatgaatggtacgtgtga

DBGET integrated database retrieval system