KEGG   Homo sapiens (human): 7555Help
Entry
7555              CDS       T01001                                 

Gene name
CNBP, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9
Definition
(RefSeq) CCHC-type zinc finger, nucleic acid binding protein
  KO
K09250  
cellular nucleic acid-binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00568  
Myotonic dystrophy (DM)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Zinc fingers of alternating composition
    7555 (CNBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q21
AA seq 177 aa AA seqDB search
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCY
SCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatgagtgcttcaagtgtggacgatctggccactgggcccgggaatgtcct
actggtggaggccgtggtcgtggaatgagaagccgtggcagaggtggttttacctcggat
agaggtttccagtttgtttcctcgtctcttccagacatttgttatcgctgtggtgagtct
ggtcatcttgccaaggattgtgatcttcaggaggatgcctgctataactgcggtagaggt
ggccacattgccaaggactgcaaggagcccaagagagagcgagagcaatgctgctacaac
tgtggcaaaccaggccatctggctcgtgactgcgaccatgcagatgagcagaaatgctat
tcttgtggagaattcggacacattcaaaaagactgcaccaaagtgaagtgctataggtgt
ggtgaaactggtcatgtagccatcaactgcagcaagacaagtgaagtcaactgttaccgc
tgtggcgagtcagggcaccttgcacgggaatgcacaattgaggctacagcctaa

DBGET integrated database retrieval system