KEGG   Homo sapiens (human): 759Help
Entry
759               CDS       T01001                                 

Gene name
CA1, CA-I, CAB, Car1, HEL-S-11
Definition
(RefSeq) carbonic anhydrase 1
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    759 (CA1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     759 (CA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 759
NCBI-ProteinID: NP_001122301
OMIM: 114800
HGNC: 1368
Ensembl: ENSG00000133742
Vega: OTTHUMG00000164941
Pharos: P00915(Tclin)
UniProt: P00915 V9HWE3
Structure
PDB: 

Jmol
Position
8q21.2
AA seq 261 aa AA seqDB search
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccagactggggatatgatgacaaaaatggtcctgaacaatggagcaagctg
tatcccattgccaatggaaataaccagtcccctgttgatattaaaaccagtgaaaccaaa
catgacacctctctgaaacctattagtgtctcctacaacccagccacagccaaagaaatt
atcaatgtggggcattccttccatgtaaattttgaggacaacgataaccgatcagtgctg
aaaggtggtcctttctctgacagctacaggctctttcagttccattttcactggggcagt
acaaatgagcatggttcagaacatacagtggatggagtcaaatattctgccgagcttcac
gtagctcactggaattctgcaaagtactccagccttgctgaagctgcctcaaaggctgat
ggtttggcagttattggtgttttgatgaaggttggtgaggccaacccaaagctgcagaaa
gtacttgatgccctccaagcaattaaaaccaagggcaaacgagccccattcacaaatttt
gacccctctactctccttccttcatccctggatttctggacctaccctggctctctgact
catcctcctctttatgagagtgtaacttggatcatctgtaaggagagcatcagtgtcagc
tcagagcagctggcacaattccgcagccttctatcaaatgttgaaggtgataacgctgtc
cccatgcagcacaacaaccgcccaacccaacctctgaagggcagaacagtgagagcttca
ttttga

DBGET integrated database retrieval system