KEGG   Homo sapiens (human): 759Help
Entry
759               CDS       T01001                                 

Gene name
CA1, CA-I, CAB, Car1, HEL-S-11
Definition
(RefSeq) carbonic anhydrase 1
  KO
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Nitrogen metabolism
Drug target
Acetazolamide (DG01134): 
Brinzolamide: 
Clofenamide: 
Diclofenamide: 
Dorzolamide (DG01135): 
Ethoxzolamide: 
Methazolamide: 
Sezolamide hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    759 (CA1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonate dehydratase
     759 (CA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.2
AA seq 261 aa AA seqDB search
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccagactggggatatgatgacaaaaatggtcctgaacaatggagcaagctg
tatcccattgccaatggaaataaccagtcccctgttgatattaaaaccagtgaaaccaaa
catgacacctctctgaaacctattagtgtctcctacaacccagccacagccaaagaaatt
atcaatgtggggcattccttccatgtaaattttgaggacaacgataaccgatcagtgctg
aaaggtggtcctttctctgacagctacaggctctttcagttccattttcactggggcagt
acaaatgagcatggttcagaacatacagtggatggagtcaaatattctgccgagcttcac
gtagctcactggaattctgcaaagtactccagccttgctgaagctgcctcaaaggctgat
ggtttggcagttattggtgttttgatgaaggttggtgaggccaacccaaagctgcagaaa
gtacttgatgccctccaagcaattaaaaccaagggcaaacgagccccattcacaaatttt
gacccctctactctccttccttcatccctggatttctggacctaccctggctctctgact
catcctcctctttatgagagtgtaacttggatcatctgtaaggagagcatcagtgtcagc
tcagagcagctggcacaattccgcagccttctatcaaatgttgaaggtgataacgctgtc
cccatgcagcacaacaaccgcccaacccaacctctgaagggcagaacagtgagagcttca
ttttga

DBGET integrated database retrieval system