KEGG   Homo sapiens (human): 7592Help
Entry
7592              CDS       T01001                                 

Gene name
ZNF41, MRX89
Definition
(RefSeq) zinc finger protein 41
  KO
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7592 (ZNF41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 821 aa AA seqDB search
MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRSSADHAALN
SIVSLQASVSFEDVTVDFSKEEWQHLDPAQRRLYWDVTLENYSHLLSVGYQIPKSEAAFK
LEQGEGPWMLEGEAPHQSCSGEAIGKMQQQGIPGGIFFHCERFDQPIGEDSLCSILEELW
QDNDQLEQRQENQNNLLSHVKVLIKERGYEHKNIEKIIHVTTKLVPSIKRLHNCDTILKH
TLNSHNHNRNSATKNLGKIFGNGNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAP
THHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP
SVYTGEKPYLCTQCGKVFTLKSNLITHQKIHTGQKPYKCSECGKAFFQRSDLFRHLRIHT
GEKPYECSECGKGFSQNSDLSIHQKTHTGEKHYECNECGKAFTRKSALRMHQRIHTGEKP
YVCADCGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFTKKSQLHVHQRIHTGEKPYICT
ECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFTDQSNLIKHQKTHTGEKPYKCNGCGK
AFIWKSRLKIHQKSHIGERHYECKDCGKAFIQKSTLSVHQRIHTGEKPYVCPECGKAFIQ
KSHFIAHHRIHTGEKPYECSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDRSNL
ITHQKIHTREKPYECGDCGKTFTWKSRLNIHQKSHTGERHYECSKCGKAFIQKATLSMHQ
IIHTGKKPYACTECQKAFTDRSNLIKHQKMHSGEKRYKASD
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaatggggactctcccccatggtccccggccctggctgcagagggacgtggc
agctcatgtgaggtgaggagggagaggaccccagaggcaagaattcattcagtgaagaga
taccctgacctgtccccagggcctaagggcagaagcagtgctgaccatgctgccttgaac
agcattgtgtcgttacaggcttcagtgtcatttgaggacgtgactgtggacttcagcaag
gaggagtggcagcacttggaccctgcccagagacgcctgtactgggatgtgacactagag
aactacagccacctgctctcagtggggtaccaaattcccaagtcagaggctgccttcaag
ttggagcaaggagaggggccatggatgctggagggggaagccccacatcagagctgttca
ggtgaggctattgggaaaatgcagcaacagggaattcctggaggaattttcttccactgt
gagagatttgatcaacccataggagaagattcattatgttctattttagaagaactgtgg
caagataatgaccagctagagcaacgtcaggaaaaccagaataaccttttaagtcatgtg
aaagtattgattaaggagaggggctatgaacataaaaacattgaaaaaataattcatgtg
actaccaagcttgttccttcaattaaaagactccataactgtgacacaattttgaagcat
actttaaactcacataatcataatagaaacagtgcaacaaagaaccttggcaagattttt
ggaaatggtaacaatttcccccatagcccttcctctactaagaatgagaatgctaaaaca
ggagcaaattcctgtgaacatgaccactatgaaaaacatctcagccacaaacaagctccc
acccaccatcagaaaattcatcctgaggagaagctttatgtgtgtactgaatgtgtaatg
ggcttcactcagaagtcacatctgtttgagcatcagagaattcatgctggagaaaagtcc
cgtgaatgtgacaaaagcaacaaagtcttcccccagaaaccccaggttgatgtacatcca
agtgtttatacaggagaaaaaccctatctgtgtactcaatgtgggaaagtctttaccctc
aaatcaaacctcattacacatcaaaaaattcataccgggcagaaaccctacaaatgcagt
gaatgtggaaaagcctttttccagagatcagacctctttagacatctgagaattcataca
ggagaaaaaccttatgaatgcagtgaatgtggaaaaggcttctcccagaactcagacctc
agtatacatcagaaaactcataccggagagaaacactatgaatgcaatgaatgtgggaag
gctttcacaagaaaatcagcactcaggatgcatcagagaatccacacgggagagaaacct
tatgtatgcgctgactgtgggaaggccttcatccagaaatcacatttcaacacacatcag
agaattcatactggagaaaagccgtatgaatgcagtgactgtgggaaatccttcactaag
aagtcacaactccatgtgcatcaaagaattcacaccggagagaaaccctatatatgtaca
gaatgtggaaaggtcttcactcacaggacaaacctcaccacacatcagaaaactcatact
ggggaaaaaccctatatgtgtgctgaatgtggaaaggcttttactgaccagtcaaatctc
attaaacaccagaaaactcacactggagagaaaccctataagtgcaatggctgtggaaaa
gccttcatatggaagtcgcgcctcaaaatacatcagaaatctcatattggagagagacac
tatgaatgcaaggactgcgggaaagccttcatccagaaatcaacactaagcgtgcatcag
agaatccatacaggagagaaaccgtacgtttgtcctgaatgcgggaaggcctttatccag
aaatcgcacttcattgcgcatcatagaatccatactggagagaagccttatgaatgcagc
gactgtgggaaatgcttcactaagaagtcacaactccgtgtgcatcagaaaatccacaca
ggtgagaagcccaatatatgtgctgaatgtggaaaggccttcactgaccgatcaaatctc
ataacacatcagaaaatccacactagggagaaaccctatgaatgtggtgactgcgggaaa
accttcacctggaagtcacgcctcaatatacatcagaagtctcatactggagaaagacac
tatgaatgtagtaaatgtgggaaagctttcatccagaaagccacactaagtatgcatcag
ataattcatacaggaaagaaaccttatgcttgtacagaatgtcagaaggcctttactgac
agatcgaatctcattaaacaccagaaaatgcatagtggagaaaaacgctataaagccagt
gactga

DBGET integrated database retrieval system