KEGG   Homo sapiens (human): 762Help
Entry
762               CDS       T01001                                 

Gene name
CA4, CAIV, Car4, RP17
Definition
carbonic anhydrase IV (EC:4.2.1.1)
Orthology
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Nitrogen metabolism
Proximal tubule bicarbonate reclamation
Disease
H00527  
Retinitis pigmentosa (RP)
Drug target
Clofenamide: 
Acetazolamide: 
Diclofenamide: 
Dorzolamide: 
Brinzolamide: 
Methazolamide: 
Other: 
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hsa00910]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23
AA seq 312 aa AA seqDB search
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgctgctggcgctcctggccctctccgcggcgcggccatcggccagtgcagag
tcacactggtgctacgaggttcaagccgagtcctccaactacccctgcttggtgccagtc
aagtggggtggaaactgccagaaggaccgccagtcccccatcaacatcgtcaccaccaag
gcaaaggtggacaaaaaactgggacgcttcttcttctctggctacgataagaagcaaacg
tggactgtccaaaataacgggcactcagtgatgatgttgctggagaacaaggccagcatt
tctggaggaggactgcctgccccataccaggccaaacagttgcacctgcactggtccgac
ttgccatataagggctcggagcacagcctcgatggggagcactttgccatggagatgcac
atagtacatgagaaagagaaggggacatcgaggaatgtgaaagaggcccaggaccctgaa
gacgaaattgcggtgctggcctttctggtggaggctggaacccaggtgaacgagggcttc
cagccactggtggaggcactgtctaatatccccaaacctgagatgagcactacgatggca
gagagcagcctgttggacctgctccccaaggaggagaaactgaggcactacttccgctac
ctgggctcactcaccacaccgacctgcgatgagaaggtcgtctggactgtgttccgggag
cccattcagcttcacagagaacagatcctggcattctctcagaagctgtactacgacaag
gaacagacagtgagcatgaaggacaatgtcaggcccctgcagcagctggggcagcgcacg
gtgataaagtccggggccccgggtcggccgctgccctgggccctgcctgccctgctgggc
cccatgctggcctgcctgctggccggcttcctgcgatga

DBGET integrated database retrieval system