KEGG   Homo sapiens (human): 762Help
Entry
762               CDS       T01001                                 

Gene name
CA4, CAIV, Car4, RP17
Definition
(RefSeq) carbonic anhydrase 4
  KO
K18246  carbonic anhydrase 4 [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa04964  Proximal tubule bicarbonate reclamation
Disease
H00527  Retinitis pigmentosa (RP)
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Topiramate: D00537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    762 (CA4)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    762 (CA4)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     762 (CA4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   762 (CA4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  762 (CA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 762
NCBI-ProteinID: NP_000708
OMIM: 114760
HGNC: 1375
Ensembl: ENSG00000167434
Vega: OTTHUMG00000179987
Pharos: P22748(Tclin)
UniProt: P22748
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 312 aa AA seqDB search
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgctgctggcgctcctggccctctccgcggcgcggccatcggccagtgcagag
tcacactggtgctacgaggttcaagccgagtcctccaactacccctgcttggtgccagtc
aagtggggtggaaactgccagaaggaccgccagtcccccatcaacatcgtcaccaccaag
gcaaaggtggacaaaaaactgggacgcttcttcttctctggctacgataagaagcaaacg
tggactgtccaaaataacgggcactcagtgatgatgttgctggagaacaaggccagcatt
tctggaggaggactgcctgccccataccaggccaaacagttgcacctgcactggtccgac
ttgccatataagggctcggagcacagcctcgatggggagcactttgccatggagatgcac
atagtacatgagaaagagaaggggacatcgaggaatgtgaaagaggcccaggaccctgaa
gacgaaattgcggtgctggcctttctggtggaggctggaacccaggtgaacgagggcttc
cagccactggtggaggcactgtctaatatccccaaacctgagatgagcactacgatggca
gagagcagcctgttggacctgctccccaaggaggagaaactgaggcactacttccgctac
ctgggctcactcaccacaccgacctgcgatgagaaggtcgtctggactgtgttccgggag
cccattcagcttcacagagaacagatcctggcattctctcagaagctgtactacgacaag
gaacagacagtgagcatgaaggacaatgtcaggcccctgcagcagctggggcagcgcacg
gtgataaagtccggggccccgggtcggccgctgccctgggccctgcctgccctgctgggc
cccatgctggcctgcctgctggccggcttcctgcgatga

DBGET integrated database retrieval system