KEGG   Homo sapiens (human): 763Help
Entry
763               CDS       T01001                                 

Gene name
CA5A, CA5, CA5AD, CAV, CAVA, GS1-21A4.1
Definition
(RefSeq) carbonic anhydrase 5A
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
Disease
H01400  Secondary hyperammonemia
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    763 (CA5A)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     763 (CA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 763
NCBI-ProteinID: NP_001730
OMIM: 114761
HGNC: 1377
Ensembl: ENSG00000174990
Vega: OTTHUMG00000137677
Pharos: P35218(Tclin)
UniProt: P35218
Position
16q24.2
AA seq 305 aa AA seqDB search
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttggggaggaacacttggaagacctcagctttctccttcttggttgagcagatgtgg
gcccctctctggagtcgttcgatgaggccagggcgatggtgttctcagcgttcctgtgca
tggcaaaccagcaataacactttgcacccactctggacggtcccggtctccgtgccaggg
ggcacccggcagtctcctattaacatccagtggagggacagcgtctatgacccccagctg
aagccactcagggtctcctatgaagcggcatcctgcctgtacatctggaacactggctac
ctcttccaggtggaatttgacgatgccaccgaggcatcaggaattagtggtgggcccttg
gaaaaccactacagactgaagcaatttcacttccactggggagcagtgaacgaggggggc
tcagagcacacagtggacggccacgcgtaccccgcagagctgcatttagttcactggaat
tctgtgaaataccaaaattacaaggaagctgtcgtgggagagaatggtttggctgtgata
ggcgtgtttttaaagctcggggcccatcatcagacgctgcagaggctggtggacatcttg
ccggaaataaaacataaggacgcgcgggcggccatgcgccccttcgacccctccactctg
ctgcccacctgctgggattactggacctacgcgggctcgctcaccaccccgccgctgacc
gagtcggtcacctggatcatccagaaggagcccgttgaagtggccccaagccagctctct
gcatttcgtactctcctgttttctgcacttggtgaagaggagaagatgatggtgaacaac
tatcgcccacttcaacccttgatgaaccggaaggtctgggcgtccttccaggccactaat
gagggcacaaggtcctag

DBGET integrated database retrieval system