KEGG   Homo sapiens (human): 763Help
Entry
763               CDS       T01001                                 

Gene name
CA5A, CA5, CA5AD, CAV, CAVA
Definition
carbonic anhydrase VA, mitochondrial (EC:4.2.1.1)
Orthology
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Nitrogen metabolism
Disease
H01400  
Secondary hyperammonemia
Drug target
Clofenamide: 
Acetazolamide: 
Diclofenamide: 
Dorzolamide: 
Brinzolamide: 
Methazolamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    763 (CA5A)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonate dehydratase
     763 (CA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 305 aa AA seqDB search
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttggggaggaacacttggaagacctcagctttctccttcttggttgagcagatgtgg
gcccctctctggagtcgttcgatgaggccagggcgatggtgttctcagcgttcctgtgca
tggcaaaccagcaataacactttgcacccactctggacggtcccggtctccgtgccaggg
ggcacccggcagtctcctattaacatccagtggagggacagcgtctatgacccccagctg
aagccactcagggtctcctatgaagcggcatcctgcctgtacatctggaacactggctac
ctcttccaggtggaatttgacgatgccaccgaggcatcaggaattagtggtgggcccttg
gaaaaccactacagactgaagcaatttcacttccactggggagcagtgaacgaggggggc
tcagagcacacagtggacggccacgcgtaccccgcagagctgcatttagttcactggaat
tctgtgaaataccaaaattacaaggaagctgtcgtgggagagaatggtttggctgtgata
ggcgtgtttttaaagctcggggcccatcatcagacgctgcagaggctggtggacatcttg
ccggaaataaaacataaggacgcgcgggcggccatgcgccccttcgacccctccactctg
ctgcccacctgctgggattactggacctacgcgggctcgctcaccaccccgccgctgacc
gagtcggtcacctggatcatccagaaggagcccgttgaagtggccccaagccagctctct
gcatttcgtactctcctgttttctgcacttggtgaagaggagaagatgatggtgaacaac
tatcgcccacttcaacccttgatgaaccggaaggtctgggcgtccttccaggccactaat
gagggcacaaggtcctag

DBGET integrated database retrieval system