KEGG   Homo sapiens (human): 7639Help
Entry
7639              CDS       T01001                                 

Gene name
ZNF85, HPF4, HTF1
Definition
zinc finger protein 85
Orthology
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    7639 (ZNF85)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p12
AA seq 625 aa AA seqDB search
MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGK
EAWSMKRHEIMVAKPTGCLSKRMSYELLRKVYILMLLRSVLYASVRIMCSHFAQDLWPEQ
NIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDK
YVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKA
FNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRF
STLTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLT
THKIIHTGEKPYKCKKCGKAFNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKI
IHTGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECEKAFNQSSKLTEHKKIHTG
EKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPY
KCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIHTGEKPYKCEE
CDKAFKWSSVLTKHKIIHTGEKLQI
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggaccattgacatttagggatgtggccatagaattctctctgaaggagtggcaatgc
ctggacactgcacagcggaatttatatagaaatgtgatgttagagaactacagaaacctg
gtcttcctgggtattactgtttctaagccagacctgatcacttgtctggagcaagggaaa
gaggcctggagtatgaagagacatgagatcatggtggccaaacccacaggttgtctatca
aaaagaatgtcgtatgagctattgagaaaggtgtatatcctgatgttactgaggagtgtt
ctctatgcctctgttagaattatgtgttctcattttgcccaagacctttggccggagcag
aatataaaagattctttccaaaaagtgacactgaaaagatatggaaaatgtagacatgaa
aatttaccattaagaaaaggctgtgaaagtatggatgagtgtaagatgcacaaaggaggt
tgtaatggacttaaccaatgtctcacagctacccagagcaaaatatttcaatgtgataaa
tatgtaaaagtcgctcataaattttcaaattcaaacagacatgagataagacatactaaa
aagaaacctttcaaatgtacaaaatgtggcaaatcatttggcatgatttcatgcctaact
gaacatagcagaattcatactagagtaaatttctacaaatgtgaagaatgtggaaaagcc
tttaactggtcctcaacccttactaaacataagagaattcatacgggagagaaaccttac
aaatgtgaagaatgtggtaaagcctttaaccagtcctcaaaccttattaaacataagaaa
attcatactggagagaaaccctacaaatgtgaagaatgtggcaaaacttttaaccgattc
tcaactcttactacccataagataattcatactggagagaaaccctacaaatgtaaagaa
tgtggtaaagcttttaaccgatcttcaacccttactacccatagaaaaattcatactgga
gagaaaccttacaaatgtgaagaatgtggcaaagcctttaagcagtcctcaaaccttact
acacataagataattcatactggagagaaaccctacaaatgtaaaaaatgtggaaaagcc
tttaaccagtctgcacaccttaccacacatgaggtaattcatactggagagaaaccctac
aaatgtgaaaaatgtggaaaagcctttaatcatttctcacaccttactacacataagata
attcatactggagagaaaccttacaaatgtaaagaatgtggtaaagcttttaaacactct
tcaacccttactaaacataagataattcatactggagagaagccttacaaatgtaaagaa
tgtgaaaaagcttttaaccaatcctcaaaacttactgaacataagaaaattcatactgga
gagaaaccctatgaatgtgaaaaatgtggcaaagcttttaaccagtcctcaaatcttact
agacataagaaaagtcatacagaagagaaaccttacaaatgtgaagaatgtggcaaaggt
tttaaatggccctcaacccttactatccataagataattcatactggagagaaaccatac
aaatgtgaagaatgtggcaaagcttttaaccaatcctcaaaacttaccaaacataagaaa
attcatactggagagaaaccctacacatgtgaagaatgtggcaaagcctttaaccagtcc
tcaaaccttactaaacataagagaattcatactggagaaaaaccttacaaatgtgaagaa
tgtgacaaagcttttaaatggtcctcagtccttactaaacataagataattcataccgga
gaaaaattacaaatatga

DBGET integrated database retrieval system