KEGG   Homo sapiens (human): 7639Help
Entry
7639              CDS       T01001                                 

Gene name
ZNF85, HPF4, HTF1
Definition
(RefSeq) zinc finger protein 85
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7639 (ZNF85)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB XPA_N Zn-ribbon_8 zf-C2H2_jaz zinc_ribbon_15 GAGA C1_4 zf-C2HE zf-H2C2_5 Zn_ribbon_SprT
Motif
Other DBs
NCBI-GeneID: 7639
NCBI-ProteinID: NP_003420
OMIM: 603899
HGNC: 13160
Ensembl: ENSG00000105750
Vega: OTTHUMG00000182747
Pharos: Q03923(Tbio)
UniProt: Q03923 Q49A12
Position
19p12
AA seq 595 aa AA seqDB search
MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGK
EAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCES
MDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCG
KSFGMISCLTEHSRIHTRVNFYKCEECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFN
QSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIHTGEKPYKCKECGKAFNRSST
LTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKAFNQSAHLTTH
EVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIH
TGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEK
PYKCEECGKGFKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTC
EECGKAFNQSSNLTKHKRIHTGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgggaccattgacatttagggatgtggccatagaattctctctgaaggagtggcaatgc
ctggacactgcacagcggaatttatatagaaatgtgatgttagagaactacagaaacctg
gtcttcctgggtattactgtttctaagccagacctgatcacttgtctggagcaagggaaa
gaggcctggagtatgaagagacatgagatcatggtggccaaacccacagttatgtgttct
cattttgcccaagacctttggccggagcagaatataaaagattctttccaaaaagtgaca
ctgaaaagatatggaaaatgtagacatgaaaatttaccattaagaaaaggctgtgaaagt
atggatgagtgtaagatgcacaaaggaggttgtaatggacttaaccaatgtctcacagct
acccagagcaaaatatttcaatgtgataaatatgtaaaagtcgctcataaattttcaaat
tcaaacagacatgagataagacatactaaaaagaaacctttcaaatgtacaaaatgtggc
aaatcatttggcatgatttcatgcctaactgaacatagcagaattcatactagagtaaat
ttctacaaatgtgaagaatgtggaaaagcctttaactggtcctcaacccttactaaacat
aagagaattcatacgggagagaaaccttacaaatgtgaagaatgtggtaaagcctttaac
cagtcctcaaaccttattaaacataagaaaattcatactggagagaaaccctacaaatgt
gaagaatgtggcaaaacttttaaccgattctcaactcttactacccataagataattcat
actggagagaaaccctacaaatgtaaagaatgtggtaaagcttttaaccgatcttcaacc
cttactacccatagaaaaattcatactggagagaaaccttacaaatgtgaagaatgtggc
aaagcctttaagcagtcctcaaaccttactacacataagataattcatactggagagaaa
ccctacaaatgtaaaaaatgtggaaaagcctttaaccagtctgcacaccttaccacacat
gaggtaattcatactggagagaaaccctacaaatgtgaaaaatgtggaaaagcctttaat
catttctcacaccttactacacataagataattcatactggagagaaaccttacaaatgt
aaagaatgtggtaaagcttttaaacactcttcaacccttactaaacataagataattcat
actggagagaagccttacaaatgtaaagaatgtgaaaaagcttttaaccaatcctcaaaa
cttactgaacataagaaaattcatactggagagaaaccctatgaatgtgaaaaatgtggc
aaagcttttaaccagtcctcaaatcttactagacataagaaaagtcatacagaagagaaa
ccttacaaatgtgaagaatgtggcaaaggttttaaatggccctcaacccttactatccat
aagataattcatactggagagaaaccatacaaatgtgaagaatgtggcaaagcttttaac
caatcctcaaaacttaccaaacataagaaaattcatactggagagaaaccctacacatgt
gaagaatgtggcaaagcctttaaccagtcctcaaaccttactaaacataagagaattcat
actggagaaaaaccttacaaatgtgaagaatgtgacaaagcttttaaatggtcctcagtc
cttactaaacataagataattcataccggagaaaaattacaaatatga

DBGET integrated database retrieval system