KEGG   Homo sapiens (human): 768Help
Entry
768               CDS       T01001                                 

Gene name
CA9, CAIX, MN
Definition
(RefSeq) carbonic anhydrase 9
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Girentuximab: D09593
Iodine: D09632
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    768 (CA9)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     768 (CA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 768
NCBI-ProteinID: NP_001207
OMIM: 603179
HGNC: 1383
Ensembl: ENSG00000107159
Vega: OTTHUMG00000021029
Pharos: Q16790(Tclin)
UniProt: Q16790 A0A0S2Z3D0
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 459 aa AA seqDB search
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG
DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL
ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT
VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA
EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS
DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctgtgccccagcccctggctccctctgttgatcccggcccctgctccaggc
ctcactgtgcaactgctgctgtcactgctgcttctggtgcctgtccatccccagaggttg
ccccggatgcaggaggattcccccttgggaggaggctcttctggggaagatgacccactg
ggcgaggaggatctgcccagtgaagaggattcacccagagaggaggatccacccggagag
gaggatctacctggagaggaggatctacctggagaggaggatctacctgaagttaagcct
aaatcagaagaagagggctccctgaagttagaggatctacctactgttgaggctcctgga
gatcctcaagaaccccagaataatgcccacagggacaaagaaggggatgaccagagtcat
tggcgctatggaggcgacccgccctggccccgggtgtccccagcctgcgcgggccgcttc
cagtccccggtggatatccgcccccagctcgccgccttctgcccggccctgcgccccctg
gaactcctgggcttccagctcccgccgctcccagaactgcgcctgcgcaacaatggccac
agtgtgcaactgaccctgcctcctgggctagagatggctctgggtcccgggcgggagtac
cgggctctgcagctgcatctgcactggggggctgcaggtcgtccgggctcggagcacact
gtggaaggccaccgtttccctgccgagatccacgtggttcacctcagcaccgcctttgcc
agagttgacgaggccttggggcgcccgggaggcctggccgtgttggccgcctttctggag
gagggcccggaagaaaacagtgcctatgagcagttgctgtctcgcttggaagaaatcgct
gaggaaggctcagagactcaggtcccaggactggacatatctgcactcctgccctctgac
ttcagccgctacttccaatatgaggggtctctgactacaccgccctgtgcccagggtgtc
atctggactgtgtttaaccagacagtgatgctgagtgctaagcagctccacaccctctct
gacaccctgtggggacctggtgactctcggctacagctgaacttccgagcgacgcagcct
ttgaatgggcgagtgattgaggcctccttccctgctggagtggacagcagtcctcgggct
gctgagccagtccagctgaattcctgcctggctgctggtgacatcctagccctggttttt
ggcctcctttttgctgtcaccagcgtcgcgttccttgtgcagatgagaaggcagcacaga
aggggaaccaaagggggtgtgagctaccgcccagcagaggtagccgagactggagcctag

DBGET integrated database retrieval system