KEGG   Homo sapiens (human): 768Help
Entry
768               CDS       T01001                                 

Gene name
CA9, CAIX, MN
Definition
carbonic anhydrase IX (EC:4.2.1.1)
Orthology
K01672  
carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Nitrogen metabolism
Drug target
Clofenamide: 
Acetazolamide: 
Diclofenamide: 
Dorzolamide: 
Brinzolamide: 
Methazolamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    768 (CA9)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonate dehydratase
     768 (CA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.3
AA seq 459 aa AA seqDB search
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG
DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL
ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT
VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA
EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS
DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctgtgccccagcccctggctccctctgttgatcccggcccctgctccaggc
ctcactgtgcaactgctgctgtcactgctgcttctggtgcctgtccatccccagaggttg
ccccggatgcaggaggattcccccttgggaggaggctcttctggggaagatgacccactg
ggcgaggaggatctgcccagtgaagaggattcacccagagaggaggatccacccggagag
gaggatctacctggagaggaggatctacctggagaggaggatctacctgaagttaagcct
aaatcagaagaagagggctccctgaagttagaggatctacctactgttgaggctcctgga
gatcctcaagaaccccagaataatgcccacagggacaaagaaggggatgaccagagtcat
tggcgctatggaggcgacccgccctggccccgggtgtccccagcctgcgcgggccgcttc
cagtccccggtggatatccgcccccagctcgccgccttctgcccggccctgcgccccctg
gaactcctgggcttccagctcccgccgctcccagaactgcgcctgcgcaacaatggccac
agtgtgcaactgaccctgcctcctgggctagagatggctctgggtcccgggcgggagtac
cgggctctgcagctgcatctgcactggggggctgcaggtcgtccgggctcggagcacact
gtggaaggccaccgtttccctgccgagatccacgtggttcacctcagcaccgcctttgcc
agagttgacgaggccttggggcgcccgggaggcctggccgtgttggccgcctttctggag
gagggcccggaagaaaacagtgcctatgagcagttgctgtctcgcttggaagaaatcgct
gaggaaggctcagagactcaggtcccaggactggacatatctgcactcctgccctctgac
ttcagccgctacttccaatatgaggggtctctgactacaccgccctgtgcccagggtgtc
atctggactgtgtttaaccagacagtgatgctgagtgctaagcagctccacaccctctct
gacaccctgtggggacctggtgactctcggctacagctgaacttccgagcgacgcagcct
ttgaatgggcgagtgattgaggcctccttccctgctggagtggacagcagtcctcgggct
gctgagccagtccagctgaattcctgcctggctgctggtgacatcctagccctggttttt
ggcctcctttttgctgtcaccagcgtcgcgttccttgtgcagatgagaaggcagcacaga
aggggaaccaaagggggtgtgagctaccgcccagcagaggtagccgagactggagcctag

DBGET integrated database retrieval system