KEGG   Homo sapiens (human): 768206Help
Entry
768206            CDS       T01001                                 

Gene name
PRCD, RP36
Definition
(RefSeq) photoreceptor disc component
  KO
K19637  
progressive rod-cone degeneration protein
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q00LT1(Tdark)
UniProt: 
Position
17q25.1
AA seq 54 aa AA seqDB search
MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccacccttttcctgctcagcaccctggccatgctctggcgccgccgatttgcc
aaccgagtccaaccagagcccagcgacgtggatggggcagctaggggcagcagcttggat
gcggaccctcagtcctcaggcagggagaaagaacctctgaagtaa

DBGET integrated database retrieval system