KEGG   Homo sapiens (human): 7706Help
Entry
7706              CDS       T01001                                 

Gene name
TRIM25, EFP, RNF147, Z147, ZNF147
Definition
(RefSeq) tripartite motif containing 25 (EC:6.3.2.19 6.3.2.n3)
  KO
K10652  
tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    7706 (TRIM25)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    7706 (TRIM25)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    7706 (TRIM25)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7706 (TRIM25)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    7706 (TRIM25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.2
AA seq 630 aa AA seqDB search
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgtgccccctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggagccggtcaccactccgtgcggccacaacttctgcgggtcgtgcctgaatgagacg
tgggcagtccagggctcgccatacctgtgcccgcagtgccgcgccgtctaccaggcgcga
ccgcagctgcacaagaacacggtgctgtgcaacgtggtggagcagttcctgcaggccgac
ctggcccgggagccacccgccgacgtctggacgccgcccgcccgcgcctctgcacccagc
ccgaatgcccaggtggcctgcgaccactgcctgaaggaggccgccgtgaagacgtgcttg
gtgtgcatggcctccttctgtcaggagcacctgcagccgcacttcgacagccccgccttc
caggaccacccgctgcagccgcccgttcgcgacctgttgcgccgcaaatgttcccagcac
aatcggctgcgggaatttttctgccccgagcacagcgagtgcatctgccacatctgcctg
gtggagcataagacctgctctcccgcgtccctgagccaggccagcgccgacctggaggcc
accctgaggcacaaactaactgtcatgtacagtcagatcaacggggcgtcgagagcactg
gatgatgtgagaaacaggcagcaggatgtgcggatgactgcaaacagaaaggtggagcag
ctacaacaagaatacacggaaatgaaggctctcttggacgcctcagagaccacctcgaca
aggaagataaaggaagaggagaagagggtcaacagcaagtttgacaccatttatcagatt
ctcctcaagaagaagagtgagatccagaccttgaaggaggagattgaacagagcctgacc
aagagggatgagttcgagtttctggagaaagcatcaaaactgcgaggaatctcaacaaag
ccagtctacatccccgaggtggaactgaaccacaagctgataaaaggcatccaccagagc
accatagacctcaaaaacgagctgaagcagtgcatcgggcggctccaggagcccaccccc
agttcaggtgaccctggagagcatgacccagcgtccacacacaaatccacacgccctgtg
aagaaggtctccaaagaggaaaagaaatccaagaaacctccccctgtccctgccttaccc
agcaagcttcccacgtttggagccccggaacagttagtggatttaaaacaagctggcttg
gaggctgcagccaaagccaccagctcacatccgaactcaacatctctcaaggccaaggtg
ctggagaccttcctggccaagtccagacctgagctcctggagtattacattaaagtcatc
ctggactacaacaccgcccacaacaaagtggctctgtcagagtgctatacagtagcttct
gtggctgagatgcctcagaactaccggccgcatccccagaggttcacatactgctctcag
gtgctgggcctgcactgctacaagaaggggatccactactgggaggtggagctgcagaag
aacaacttctgtggggtaggcatctgctacggaagcatgaaccggcagggcccagaaagc
aggctcggccgcaacagcgcctcctggtgcgtggagtggttcaacaccaagatctctgcc
tggcacaataacgtggagaaaaccctgccctccaccaaggccacgcgggtgggcgtgctt
ctcaactgtgaccacggctttgtcatcttcttcgctgttgccgacaaggtccacctgatg
tataagttcagggtggactttactgaggctttgtacccggctttctgggtattttctgct
ggtgccacactctccatctgctcccccaagtag

DBGET integrated database retrieval system