KEGG   Homo sapiens (human): 7706Help
Entry
7706              CDS       T01001                                 

Gene name
TRIM25, EFP, RNF147, Z147, ZNF147
Definition
tripartite motif containing 25 (EC:6.3.2.19 6.3.2.n3)
Orthology
K10652  
tripartite motif-containing protein 25 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
RIG-I-like receptor signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.2
AA seq 630 aa AA seqDB search
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgtgccccctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggagccggtcaccactccgtgcggccacaacttctgcgggtcgtgcctgaatgagacg
tgggcagtccagggctcgccatacctgtgcccgcagtgccgcgccgtctaccaggcgcga
ccgcagctgcacaagaacacggtgctgtgcaacgtggtggagcagttcctgcaggccgac
ctggcccgggagccacccgccgacgtctggacgccgcccgcccgcgcctctgcacccagc
ccgaatgcccaggtggcctgcgaccactgcctgaaggaggccgccgtgaagacgtgcttg
gtgtgcatggcctccttctgtcaggagcacctgcagccgcacttcgacagccccgccttc
caggaccacccgctgcagccgcccgttcgcgacctgttgcgccgcaaatgttcccagcac
aatcggctgcgggaatttttctgccccgagcacagcgagtgcatctgccacatctgcctg
gtggagcataagacctgctctcccgcgtccctgagccaggccagcgccgacctggaggcc
accctgaggcacaaactaactgtcatgtacagtcagatcaacggggcgtcgagagcactg
gatgatgtgagaaacaggcagcaggatgtgcggatgactgcaaacagaaaggtggagcag
ctacaacaagaatacacggaaatgaaggctctcttggacgcctcagagaccacctcgaca
aggaagataaaggaagaggagaagagggtcaacagcaagtttgacaccatttatcagatt
ctcctcaagaagaagagtgagatccagaccttgaaggaggagattgaacagagcctgacc
aagagggatgagttcgagtttctggagaaagcatcaaaactgcgaggaatctcaacaaag
ccagtctacatccccgaggtggaactgaaccacaagctgataaaaggcatccaccagagc
accatagacctcaaaaacgagctgaagcagtgcatcgggcggctccaggagcccaccccc
agttcaggtgaccctggagagcatgacccagcgtccacacacaaatccacacgccctgtg
aagaaggtctccaaagaggaaaagaaatccaagaaacctccccctgtccctgccttaccc
agcaagcttcccacgtttggagccccggaacagttagtggatttaaaacaagctggcttg
gaggctgcagccaaagccaccagctcacatccgaactcaacatctctcaaggccaaggtg
ctggagaccttcctggccaagtccagacctgagctcctggagtattacattaaagtcatc
ctggactacaacaccgcccacaacaaagtggctctgtcagagtgctatacagtagcttct
gtggctgagatgcctcagaactaccggccgcatccccagaggttcacatactgctctcag
gtgctgggcctgcactgctacaagaaggggatccactactgggaggtggagctgcagaag
aacaacttctgtggggtaggcatctgctacggaagcatgaaccggcagggcccagaaagc
aggctcggccgcaacagcgcctcctggtgcgtggagtggttcaacaccaagatctctgcc
tggcacaataacgtggagaaaaccctgccctccaccaaggccacgcgggtgggcgtgctt
ctcaactgtgaccacggctttgtcatcttcttcgctgttgccgacaaggtccacctgatg
tataagttcagggtggactttactgaggctttgtacccggctttctgggtattttctgct
ggtgccacactctccatctgctcccccaagtag

DBGET integrated database retrieval system