KEGG   Homo sapiens (human): 7709Help
Entry
7709              CDS       T01001                                 

Gene name
ZBTB17, MIZ-1, ZNF151, ZNF60, pHZ-67
Definition
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  
zinc finger and BTB domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7709 (ZBTB17)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7709 (ZBTB17)
   05202 Transcriptional misregulation in cancers
    7709 (ZBTB17)
   05222 Small cell lung cancer
    7709 (ZBTB17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     7709 (ZBTB17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13105(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.13
AA seq 803 aa AA seqDB search
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggactttccccagcacagccagcatgtcttggaacagctgaaccagcagcggcagctg
gggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaaggacgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggcc
aagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccactttcctccaa
atgcaggacatcatcacggcctgccatgccctcaagtcacttgctgagccggctaccagc
cctgggggaaatgcggaggccttggccacagaaggaggggacaagagagccaaagaggag
aaggtggccaccagcacgctgagcaggctggagcaggcaggacgcagcacacccataggc
cccagcagggacctcaaggaggagcgcggcggtcaggcccagagtgcggccagcggtgca
gagcagacagagaaagccgatgcgccccgggagccgccgcctgtggagctcaagccagac
cccacgagtggcatggctgctgcagaagctgaggccgctttgtccgagagctcggagcaa
gaaatggaggtggagcccgcccggaaaggggaagaggagcaaaaggagcaagaggagcaa
gaggaggagggcgcagggccagctgaggtcaaggaggagggttcccagctggagaacgga
gaggcccccgaggagaacgagaatgaggagtcagcgggcacagactcggggcaggagctc
ggctccgaggcccggggcctgcgctcaggcacctacggcgaccgcacggagtccaaggcc
tacggctccgtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaac
ttcaagcggcacatccgcatccacacgggggagaagcccttctcgtgccgggagtgcagc
aaggccttttccgacccggccgcgtgcaaggcccatgagaagacgcacagccctctgaag
ccctacggctgcgaggagtgcgggaagagctaccgcctcatcagcctgctgaacctgcac
aagaagcggcactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcacc
acctcgggcaacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgc
gactactgcggccgctccttctccgaccccacttccaagatgcgccacctggagacccac
gacacggacaaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaac
ctgaaggcccacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtggg
aagcagttcaccacctcagggaacctgaagcggcaccttcggatccacagcggggagaag
ccctacgtgtgcatccactgccagcgacagtttgcagaccccggcgctctgcagcggcac
gtccgcattcacacaggtgagaagccatgccagtgtgtgatgtgcggtaaggccttcacc
caggccagctccctcatcgcccacgtgcgccagcacaccggggagaagccctacgtctgc
gagcgctgcggcaagagattcgtccagtccagccagttggccaatcatattcgccaccac
gacaacatccgcccacacaagtgcagcgtgtgcagcaaggccttcgtgaacgtgggggac
ctgtccaagcacatcatcattcacactggagagaagccttacctgtgtgataagtgtggg
cgtggcttcaaccgggtagacaacctgcgctcccacgtgaagaccgtgcaccagggcaag
gcaggcatcaagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggat
gacatggtcacgctggctaccgaggcactggcagcgacagccgtcactcagctcacagtg
gtgccggtgggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagc
aaagctgtgaagcaagtgcaggaagaagaccccaacactcacatcctctacgcctgtgac
tcctgtggggacaagtttctggatgccaacagcctggctcagcatgtgcgaatccacaca
gcccaggcactggtcatgttccagacagacgcggacttctatcagcagtatgggccaggt
ggcacgtggcctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgcgac
ggggctgagggccagcccgcactggcagagacctcccctacagctcctgaatgtcccccg
cctgccgagtga

DBGET integrated database retrieval system