KEGG   Homo sapiens (human): 7709Help
Entry
7709              CDS       T01001                                 

Gene name
ZBTB17, MIZ-1, ZNF151, ZNF60, pHZ-67
Definition
(RefSeq) zinc finger and BTB domain containing 17
  KO
K10500  
zinc finger and BTB domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7709 (ZBTB17)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    7709 (ZBTB17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     7709 (ZBTB17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.13
AA seq 803 aa AA seqDB search
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggactttccccagcacagccagcatgtcttggaacagctgaaccagcagcggcagctg
gggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaaggacgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggcc
aagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccactttcctccaa
atgcaggacatcatcacggcctgccatgccctcaagtcacttgctgagccggctaccagc
cctgggggaaatgcggaggccttggccacagaaggaggggacaagagagccaaagaggag
aaggtggccaccagcacgctgagcaggctggagcaggcaggacgcagcacacccataggc
cccagcagggacctcaaggaggagcgcggcggtcaggcccagagtgcggccagcggtgca
gagcagacagagaaagccgatgcgccccgggagccgccgcctgtggagctcaagccagac
cccacgagtggcatggctgctgcagaagctgaggccgctttgtccgagagctcggagcaa
gaaatggaggtggagcccgcccggaaaggggaagaggagcaaaaggagcaagaggagcaa
gaggaggagggcgcagggccagctgaggtcaaggaggagggttcccagctggagaacgga
gaggcccccgaggagaacgagaatgaggagtcagcgggcacagactcggggcaggagctc
ggctccgaggcccggggcctgcgctcaggcacctacggcgaccgcacggagtccaaggcc
tacggctccgtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaac
ttcaagcggcacatccgcatccacacgggggagaagcccttctcgtgccgggagtgcagc
aaggccttttccgacccggccgcgtgcaaggcccatgagaagacgcacagccctctgaag
ccctacggctgcgaggagtgcgggaagagctaccgcctcatcagcctgctgaacctgcac
aagaagcggcactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcacc
acctcgggcaacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgc
gactactgcggccgctccttctccgaccccacttccaagatgcgccacctggagacccac
gacacggacaaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaac
ctgaaggcccacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtggg
aagcagttcaccacctcagggaacctgaagcggcaccttcggatccacagcggggagaag
ccctacgtgtgcatccactgccagcgacagtttgcagaccccggcgctctgcagcggcac
gtccgcattcacacaggtgagaagccatgccagtgtgtgatgtgcggtaaggccttcacc
caggccagctccctcatcgcccacgtgcgccagcacaccggggagaagccctacgtctgc
gagcgctgcggcaagagattcgtccagtccagccagttggccaatcatattcgccaccac
gacaacatccgcccacacaagtgcagcgtgtgcagcaaggccttcgtgaacgtgggggac
ctgtccaagcacatcatcattcacactggagagaagccttacctgtgtgataagtgtggg
cgtggcttcaaccgggtagacaacctgcgctcccacgtgaagaccgtgcaccagggcaag
gcaggcatcaagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggat
gacatggtcacgctggctaccgaggcactggcagcgacagccgtcactcagctcacagtg
gtgccggtgggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagc
aaagctgtgaagcaagtgcaggaagaagaccccaacactcacatcctctacgcctgtgac
tcctgtggggacaagtttctggatgccaacagcctggctcagcatgtgcgaatccacaca
gcccaggcactggtcatgttccagacagacgcggacttctatcagcagtatgggccaggt
ggcacgtggcctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgcgac
ggggctgagggccagcccgcactggcagagacctcccctacagctcctgaatgtcccccg
cctgccgagtga

DBGET integrated database retrieval system