KEGG   Homo sapiens (human): 7709Help
Entry
7709              CDS       T01001                                 

Gene name
ZBTB17, MIZ-1, ZNF151, ZNF60, pHZ-67
Definition
zinc finger and BTB domain containing 17
Orthology
K10500  
zinc finger and BTB domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Transcriptional misregulation in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.13
AA seq 721 aa AA seqDB search
MMCWPWPLSSKCRTSSRPAMPSSHLLSRLPALGEMRRPWPQKVCPVPSPGGDKRAKEEKV
ATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPDPT
SGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLENGEA
PEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFK
RHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKK
RHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDT
DKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPY
VCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCER
CGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRG
FNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVP
VGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQ
ALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPA
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgctggccgtggccactttcctccaaatgcaggacatcatcacggcctgccatg
ccctcaagtcacttgctgagccggctaccagccctgggggaaatgcggaggccttggcca
cagaaggtctgccctgttccatctccaggaggggacaagagagccaaagaggagaaggtg
gccaccagcacgctgagcaggctggagcaggcaggacgcagcacacccataggccccagc
agggacctcaaggaggagcgcggcggtcaggcccagagtgcggccagcggtgcagagcag
acagagaaagccgatgcgccccgggagccgccgcctgtggagctcaagccagaccccacg
agtggcatggctgctgcagaagctgaggccgctttgtccgagagctcggagcaagaaatg
gaggtggagcccgcccggaaaggggaagaggagcaaaaggagcaagaggagcaagaggag
gagggcgcagggccagctgaggtcaaggaggagggttcccagctggagaacggagaggcc
cccgaggagaacgagaatgaggagtcagcgggcacagactcggggcaggagctcggctcc
gaggcccggggcctgcgctcaggcacctacggcgaccgcacggagtccaaggcctacggc
tccgtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaacttcaag
cggcacatccgcatccacacgggggagaagcccttctcgtgccgggagtgcagcaaggcc
ttttccgacccggccgcgtgcaaggcccatgagaagacgcacagccctctgaagccctac
ggctgcgaggagtgcgggaagagctaccgcctcatcagcctgctgaacctgcacaagaag
cggcactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcaccacctcg
ggcaacctcaagcgccaccagctggtgcacagcggcgagaagccctaccagtgcgactac
tgcggccgctccttctccgaccccacttccaagatgcgccacctggagacccacgacacg
gacaaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaacctgaag
gcccacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtgggaagcag
ttcaccacctcagggaacctgaagcggcaccttcggatccacagcggggagaagccctac
gtgtgcatccactgccagcgacagtttgcagaccccggcgctctgcagcggcacgtccgc
attcacacaggtgagaagccatgccagtgtgtgatgtgcggtaaggccttcacccaggcc
agctccctcatcgcccacgtgcgccagcacaccggggagaagccctacgtctgcgagcgc
tgcggcaagagattcgtccagtccagccagttggccaatcatattcgccaccacgacaac
atccgcccacacaagtgcagcgtgtgcagcaaggccttcgtgaacgtgggggacctgtcc
aagcacatcatcattcacactggagagaagccttacctgtgtgataagtgtgggcgtggc
ttcaaccgggtagacaacctgcgctcccacgtgaagaccgtgcaccagggcaaggcaggc
atcaagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggatgacatg
gtcacgctggctaccgaggcactggcagcgacagccgtcactcagctcacagtggtgccg
gtgggagctgcagtgacagccgatgagacggaagtcctgaaggccgagatcagcaaagct
gtgaagcaagtgcaggaagaagaccccaacactcacatcctctacgcctgtgactcctgt
ggggacaagtttctggatgccaacagcctggctcagcatgtgcgaatccacacagcccag
gcactggtcatgttccagacagacgcggacttctatcagcagtatgggccaggtggcacg
tggcctgccgggcaggtgctgcaggctggggagctggtcttccgccctcgcgacggggct
gagggccagcccgcactggcagagacctcccctacagctcctgaatgtcccccgcctgcc
gagtga

DBGET integrated database retrieval system