KEGG   Homo sapiens (human): 773Help
Entry
773               CDS       T01001                                 

Gene name
CACNA1A, APCA, BI, CACNL1A4, CAV2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6
Definition
calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
Orthology
K04344  
voltage-dependent calcium channel P/Q type alpha-1A
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Type II diabetes mellitus
Morphine addiction
Nicotine addiction
Disease
H00063  
Spinocerebellar ataxia (SCA)
H00749  
Episodic ataxias
H00775  
Familial or sporadic hemiplegic migraine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    773 (CACNA1A)
   04020 Calcium signaling pathway
    773 (CACNA1A)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    773 (CACNA1A)
   04727 GABAergic synapse
    773 (CACNA1A)
   04725 Cholinergic synapse
    773 (CACNA1A)
   04728 Dopaminergic synapse
    773 (CACNA1A)
   04726 Serotonergic synapse
    773 (CACNA1A)
   04730 Long-term depression
    773 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    773 (CACNA1A)
   04721 Synaptic vesicle cycle
    773 (CACNA1A)
  Sensory system
   04742 Taste transduction
    773 (CACNA1A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    773 (CACNA1A)
   05033 Nicotine addiction
    773 (CACNA1A)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    773 (CACNA1A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   773 (CACNA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13
AA seq 2266 aa AA seqDB search
MARFGDEMPARYGGGGSGAAAGVVVGSGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGA
LRRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYI
RRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYG
LGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASL
RNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMT
VFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKVEADEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQ
RTSEMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTN
KSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGP
YGRESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEHR
RHRAHRRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGD
ARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATA
ESAAPHGSLGHAGLPQSPAKMGNSTDPGPMLAIPAMATNPQNAASRRTPNNPGNPSNPGP
PKTPENSLIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPK
KEEEKKEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMS
SIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILD
FIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNV
FNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWK
KYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQY
RMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKV
MAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNPNNFINLSFLRLFRAARLIKLLRQG
YTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITE
HNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFI
FLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQM
LRHMSPPLGLGKKCPARVAYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGAD
KQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQ
AMREEQDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQR
AQEMFQKTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMP
RLPAENQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQR
RRDRSHRASERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHH
HHHHHPPPPDKDRYAQERPDHGRARARDQRWSRSPSEGREHMAHRQ
NT seq 6801 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcttcggagacgagatgccggcccgctacgggggaggaggctccggggcagcc
gccggggtggtcgtgggcagcggaggcgggcgaggagccgggggcagccggcagggcggg
cagcccggggcgcaaaggatgtacaagcagtcaatggcgcagagagcgcggaccatggca
ctctacaaccccatccccgtccgacagaactgcctcacggttaaccggtctctcttcctc
ttcagcgaagacaacgtggtgagaaaatacgccaaaaagatcaccgaatggcctcccttt
gaatatatgattttagccaccatcatagcgaattgcatcgtcctcgcactggagcagcat
ctgcctgatgatgacaagaccccgatgtctgaacggctggatgacacagaaccatacttc
attggaattttttgtttcgaggctggaattaaaatcattgcccttgggtttgccttccac
aaaggctcctacttgaggaatggctggaatgtcatggactttgtggtggtgctaacgggc
atcttggcgacagttgggacggagtttgacctacggacgctgagggcagttcgagtgctg
cggccgctcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtcgatcatg
aaggcgatgatccctttgctgcagatcggcctcctcctattttttgcaatccttattttt
gcaatcatagggttagaattttatatgggaaaatttcataccacctgctttgaagagggg
acagatgacattcagggtgagtctccggctccatgtgggacagaagagcccgcccgcacc
tgccccaatgggaccaaatgtcagccctactgggaagggcccaacaacgggatcactcag
ttcgacaacatcctgtttgcagtgctgactgttttccagtgcataaccatggaagggtgg
actgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttgtacttc
atccccctcatcatcatcggctccttttttatgctgaaccttgtgctgggtgtgctgtca
ggggagtttgccaaagaaagggaacgggtggagaaccggcgggcttttctgaagctgagg
cggcaacaacagattgaacgtgagctcaatgggtacatggagtggatctcaaaagcagaa
gaggtgatcctcgccgaggatgaaactgacggggagcagaggcatccctttgatggagct
ctgcggagaaccaccataaagaaaagcaagacagatttgctcaaccccgaagaggctgag
gatcagctggctgatatagcctctgtgggttctcccttcgcccgagccagcattaaaagt
gccaagctggagaactcgaccttttttcacaaaaaggagaggaggatgcgtttctacatc
cgccgcatggtcaaaactcaggccttctactggactgtactcagtttggtagctctcaac
acgctgtgtgttgctattgttcactacaaccagcccgagtggctctccgacttcctttac
tatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatgtacggg
cttgggacgcggccttacttccactcttccttcaactgctttgactgtggggttatcatt
gggagcatcttcgaggtcatctgggctgtcataaaacctggcacatcctttggaatcagc
gtgttacgagccctcaggttattgcgtattttcaaagtcacaaagtactgggcatctctc
agaaacctggtcgtctctctcctcaactccatgaagtccatcatcagcctgttgtttctc
cttttcctgttcattgtcgtcttcgcccttttgggaatgcaactcttcggcggccagttt
aatttcgatgaagggactcctcccaccaacttcgatacttttccagcagcaataatgacg
gtgtttcagatcctgacgggcgaagactggaacgaggtcatgtacgacgggatcaagtct
caggggggcgtgcagggcggcatggtgttctccatctatttcattgtactgacgctcttt
gggaactacaccctcctgaatgtgttcttggccatcgctgtggacaatctggccaacgcc
caggagctcaccaaggtggaggcggacgagcaagaggaagaagaagcagcgaaccagaaa
cttgccctacagaaagccaaggaggtggcagaagtgagtcctctgtccgcggccaacatg
tctatagctgtgaaagagcaacagaagaatcaaaagccagccaagtccgtgtgggagcag
cggaccagtgagatgcgaaagcagaacttgctggccagccgggaggccctgtataacgaa
atggacccggacgagcgctggaaggctgcctacacgcggcacctgcggccagacatgaag
acgcacttggaccggccgctggtggtggacccgcaggagaaccgcaacaacaacaccaac
aagagccgggcggccgagcccaccgtggaccagcgcctcggccagcagcgcgccgaggac
ttcctcaggaaacaggcccgctaccacgatcgggcccgggaccccagcggctcggcgggc
ctggacgcacggaggccctgggcgggaagccaggaggccgagctgagccgggagggaccc
tacggccgcgagtcggaccaccacgcccgggagggcagcctggagcaacccgggttctgg
gagggcgaggccgagcgaggcaaggccggggacccccaccggaggcacgtgcaccggcag
gggggcagcagggagagccgcagcgggtccccgcgcacgggcgcggacggggagcatcga
cgtcatcgcgcgcaccgcaggcccggggaggagggtccggaggacaaggcggagcggagg
gcgcggcaccgcgagggcagccggccggcccggggcggcgagggcgagggcgagggcccc
gacgggggcgagcgcaggagaaggcaccggcatggcgctccagccacgtacgagggggac
gcgcggagggaggacaaggagcggaggcatcggaggaggaaagagaaccagggctccggg
gtccctgtgtcgggccccaacctgtcaaccacccggccaatccagcaggacctgggccgc
caagacccacccctggcagaggatattgacaacatgaagaacaacaagctggccaccgcg
gagtcggccgctccccacggcagccttggccacgccggcctgccccagagcccagccaag
atgggaaacagcaccgaccccggccccatgctggccatccctgccatggccaccaacccc
cagaacgccgccagccgccggacgcccaacaacccggggaacccatccaatcccggcccc
cccaagacccccgagaatagccttatcgtcaccaaccccagcggcacccagaccaattca
gctaagactgccaggaaacccgaccacaccacagtggacatccccccagcctgcccaccc
cccctcaaccacaccgtcgtacaagtgaacaaaaacgccaacccagacccactgccaaaa
aaagaggaagagaagaaggaggaggaggaagacgaccgtggggaagacggccctaagcca
atgcctccctatagctccatgttcatcctgtccacgaccaacccccttcgccgcctgtgc
cattacatcctgaacctgcgctactttgagatgtgcatcctcatggtcattgccatgagc
agcatcgccctggccgccgaggaccctgtgcagcccaacgcacctcggaacaacgtgctg
cgatactttgactacgtttttacaggcgtctttacctttgagatggtgatcaagatgatt
gacctggggctcgtcctgcatcagggtgcctacttccgtgacctctggaatattctcgac
ttcatagtggtcagtggggccctggtagcctttgccttcactggcaatagcaaaggaaaa
gacatcaacacgattaaatccctccgagtcctccgggtgctacgacctcttaaaaccatc
aagcggctgccaaagctcaaggctgtgtttgactgtgtggtgaactcacttaaaaacgtc
ttcaacatcctcatcgtctacatgctattcatgttcatcttcgccgtggtggctgtgcag
ctcttcaaggggaaattcttccactgcactgacgagtccaaagagtttgagaaagattgt
cgaggcaaatacctcctctacgagaagaatgaggtgaaggcgcgagaccgggagtggaag
aagtatgaattccattacgacaatgtgctgtgggctctgctgaccctcttcaccgtgtcc
acgggagaaggctggccacaggtcctcaagcattcggtggacgccacctttgagaaccag
ggccccagccccgggtaccgcatggagatgtccattttctacgtcgtctactttgtggtg
ttccccttcttctttgtcaatatctttgtggccttgatcatcatcaccttccaggagcaa
ggggacaagatgatggaggaatacagcctggagaaaaatgagagggcctgcattgatttc
gccatcagcgccaagccgctgacccgacacatgccgcagaacaagcagagcttccagtac
cgcatgtggcagttcgtggtgtctccgcctttcgagtacacgatcatggccatgatcgcc
ctcaacaccatcgtgcttatgatgaagttctatggggcttctgttgcttatgaaaatgcc
ctgcgggtgttcaacatcgtcttcacctccctcttctctctggaatgtgtgctgaaagtc
atggcttttgggattctgaattatttccgcgatgcctggaacatcttcgactttgtgact
gttctgggcagcatcaccgatatcctcgtgactgagtttgggaatccgaataacttcatc
aacctgagctttctccgcctcttccgagctgcccggctcatcaaacttctccgtcagggt
tacaccatccgcattcttctctggacctttgtgcagtccttcaaggccctgccttatgtc
tgtctgctgatcgccatgctcttcttcatctatgccatcattgggatgcaggtgtttggt
aacattggcatcgacgtggaggacgaggacagtgatgaagatgagttccaaatcactgag
cacaataacttccggaccttcttccaggccctcatgcttctcttccggagtgccaccggg
gaagcttggcacaacatcatgctttcctgcctcagcgggaaaccgtgtgataagaactct
ggcatcctgactcgagagtgtggcaatgaatttgcttatttttactttgtttccttcatc
ttcctctgctcgtttctgatgctgaatctctttgtcgccgtcatcatggacaactttgag
tacctcacccgagactcctccatcctgggcccccaccacctggatgagtacgtgcgtgtc
tgggccgagtatgaccccgcagcttggggccgcatgccttacctggacatgtatcagatg
ctgagacacatgtctccgcccctgggtctggggaagaagtgtccggccagagtggcttac
aagcggcttctgcggatggacctgcccgtcgcagatgacaacaccgtccacttcaattcc
accctcatggctctgatccgcacagccctggacatcaagattgccaagggaggagccgac
aaacagcagatggacgctgagctgcggaaggagatgatggcgatttggcccaatctgtcc
cagaagacgctagacctgctggtcacacctcacaagtccacggacctcaccgtggggaag
atctacgcagccatgatgatcatggagtactaccggcagagcaaggccaagaagctgcag
gccatgcgcgaggagcaggaccggacacccctcatgttccagcgcatggagcccccgtcc
ccaacgcaggaagggggacctggccagaacgccctcccctccacccagctggacccagga
ggagccctgatggctcacgaaagcggcctcaaggagagcccgtcctgggtgacccagcgt
gcccaggagatgttccagaagacgggcacatggagtccggaacaaggcccccctaccgac
atgcccaacagccagcctaactctcagtccgtggagatgcgagagatgggcagagatggc
tactccgacagcgagcactacctccccatggaaggccagggccgggctgcctccatgccc
cgcctccctgcagagaaccagaggagaaggggccggccacgtgggaataacctcagtacc
atctcagacaccagccccatgaagcgttcagcctccgtgctgggccccaaggcccgacgc
ctggacgattactcgctggagcgggtcccgcccgaggagaaccagcggcaccaccagcgg
cgccgcgaccgcagccaccgcgcctctgagcgctccctgggccgctacaccgatgtggac
acaggcttggggacagacctgagcatgaccacccaatccggggacctgccgtcgaaggag
cgggaccaggagcggggccggcccaaggatcggaagcatcgacagcaccaccaccaccac
caccaccaccaccatcccccgccccccgacaaggaccgctatgcccaggaacggccggac
cacggccgggcacgggctcgggaccagcgctggtcccgctcgcccagcgagggccgagag
cacatggcgcaccggcagtag

DBGET integrated database retrieval system