KEGG   Homo sapiens (human): 775Help
Entry
775               CDS       T01001                                 

Gene name
CACNA1C, CACH2, CACN2, CACNL1A1, CCHL1A1, CaV1.2, LQT8, TS
Definition
calcium channel, voltage-dependent, L type, alpha 1C subunit
Orthology
K04850  
voltage-dependent calcium channel L type alpha-1C
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Insulin secretion
GnRH signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Alzheimer's disease
Amphetamine addiction
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00720  
Long QT syndrome
H00728  
Brugada syndrome (BRS)
Drug target
Dronedarone: 
Amlodipine: 
Felodipine: 
Isradipine: 
Nicardipine: 
Nifedipine: 
Nimodipine: 
Nisoldipine: 
Nitrendipine: 
Lacidipine: 
Nilvadipine: 
Manidipine: 
Barnidipine: 
Lercanidipine: 
Cilnidipine: 
Benidipine: 
Clevidipine: 
Verapamil: 
Gallopamil: 
Diltiazem: 
Fendiline: 
Bepridil: 
Perhexiline: 
Topiramate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    775 (CACNA1C)
   04020 Calcium signaling pathway
    775 (CACNA1C)
   04022 cGMP - PKG signaling pathway
    775 (CACNA1C)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    775 (CACNA1C)
   04912 GnRH signaling pathway
    775 (CACNA1C)
   04921 Oxytocin signaling pathway
    775 (CACNA1C)
  Circulatory system
   04260 Cardiac muscle contraction
    775 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    775 (CACNA1C)
   04270 Vascular smooth muscle contraction
    775 (CACNA1C)
  Nervous system
   04724 Glutamatergic synapse
    775 (CACNA1C)
   04727 GABAergic synapse
    775 (CACNA1C)
   04725 Cholinergic synapse
    775 (CACNA1C)
   04728 Dopaminergic synapse
    775 (CACNA1C)
   04726 Serotonergic synapse
    775 (CACNA1C)
   04720 Long-term potentiation
    775 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    775 (CACNA1C)
  Environmental adaptation
   04713 Circadian entrainment
    775 (CACNA1C)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    775 (CACNA1C)
  Substance dependence
   05031 Amphetamine addiction
    775 (CACNA1C)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    775 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    775 (CACNA1C)
   05414 Dilated cardiomyopathy (DCM)
    775 (CACNA1C)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    775 (CACNA1C)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-1, CaVx.x
   775 (CACNA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.3
AA seq 2138 aa AA seqDB search
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDT
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSP
AIRVQEVAWKLSSNRCHSRESQAAMAGQEETSQDETYEVKMNHDTEACSEPSLLSTEMLS
YQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVL
PLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESS
EKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNC
RDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
NT seq 6417 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccacgccccgcccatgccaacatgaatgccaatgcggcagcggggctggcccct
gagcacatccccaccccgggggctgccctgtcgtggcaggcggccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaatgcgaccatctccacagtcagctccacgcag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagatgattccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttacggtggaagcgtttttaaaagtaatcgcc
tatggactcctctttcaccccaatgcctacctccgcaacggctggaacctactagatttt
ataattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gcaaacgctctcggagggaaaggggccggatttgatgtgaaggcgctgagggccttccgc
gtgctgcgccccctgcggctggtgtccggagtcccaagtctccaggtggtcctgaattcc
atcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgtttgtcatcatc
atctacgccatcatcggcttggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatagcagatgttccagcagaagatgacccttccccttgtgcgctggaaacg
ggccacgggcggcagtgccagaacggcacggtgtgcaagcccggctgggatggtcccaag
cacggcatcaccaactttgacaactttgccttcgccatgctcacggtgttccagtgcatc
accatggagggctggacggacgtgctgtactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgtgcttagcggagagttttccaaagagagggagaaggccaaggcccggggagat
ttccagaagctgcgggagaagcagcagctagaagaggatctcaaaggctacctggattgg
atcactcaggccgaagacatcgatcctgagaatgaggacgaaggcatggatgaggagaag
ccccgaaacatgagcatgcccaccagtgagaccgagtccgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagaaaactgcggggccaggctggcccaccggatctccaagtca
aagttcagccgctactggcgccggtggaatcggttctgcagaaggaagtgccgcgccgca
gtcaagtctaatgtcttctactggctggtgattttcctggtgttcctcaacacgctcacc
attgcctctgagcactacaaccagcccaactggctcacagaagtccaagacacggcaaac
aaggccctgctggccctgttcacggcagagatgctcctgaagatgtacagcctgggcctg
caggcctacttcgtgtccctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatc
ctggagaccatcctggtggagaccaagatcatgtccccactgggcatctccgtgctcaga
tgcgtccggctgctgaggattttcaagatcacgaggtactggaactccttgagcaacctg
gtggcatccttgctgaactctgtgcgctccatcgcctccctgctccttctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gagatgcagacccggaggagcacattcgataacttcccccagtccctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaggaagaggagaaggagagaaagaagctggccagg
actgccagcccagagaagaaacaagagttggtggagaagccggcagtgggggaatccaag
gaggagaagattgagctgaaatccatcacggctgacggagagtctccacccgccaccaag
atcaacatggatgacctccagcccaatgaaaatgaggataagagcccctaccccaaccca
gaaactacaggagaagaggatgaggaggagccagagatgcctgtcggccctcgcccacga
ccactctctgagcttcaccttaaggaaaaggcagtgcccatgccagaagccagcgcgttt
ttcatcttcagctctaacaacaggtttcgcctccagtgccaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctggctgctgag
gacccggtccagcacacctccttcaggaaccatattctgttttattttgatattgttttt
accaccattttcaccattgaaattgctctgaagatgactgcttatggggctttcttgcac
aagggttctttctgccggaactacttcaacatcctggacctgctggtggtcagcgtgtcc
ctcatctcctttggcatccagtccagtgcaatcaatgtcgtgaagatcttgcgagtcctg
cgagtactcaggcccctgagggccatcaacagggccaaggggctaaagcatgtggttcag
tgtgtgtttgtcgccatccggaccatcgggaacatcgtgattgtcaccaccctgctgcag
ttcatgtttgcctgcatcggggtccagctcttcaagggaaagctgtacacctgttcagac
agttccaagcagacagaggcggaatgcaagggcaactacatcacgtacaaagacggggag
gttgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaat
gttctggcagccatgatggccctcttcaccgtctccaccttcgaagggtggccagagctg
ctgtaccgctccatcgactcccacacggaagacaagggccccatctacaactaccgtgtg
gagatctccatcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatc
ttcgtgggcttcgtcatcgtcacctttcaggagcagggggagcaggagtacaagaactgt
gagctggacaagaaccagcgacagtgcgtggaatacgccctcaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcac
tacggccagagctgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggc
ctcttcaccgtggagatgatcctgaagctcattgccttcaaacccaagcactatttctgt
gatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatc
accgaggtaaacccagctgaacatacccaatgctctccctctatgaacgcagaggaaaac
tcccgcatctccatcaccttcttccgcctgttccgggtcatgcgtctggtgaagctgctg
agccgtggggagggcatccggacgctgctgtggaccttcatcaagtccttccaggccctg
ccctatgtggccctcctgatcgtgatgctgttcttcatctacgcggtgatcgggatgcag
gtgtttgggaaaattgccctgaatgataccacagagatcaaccggaacaacaactttcag
accttcccccaggccgtgctgctcctcttcaggtgtgccaccggggaggcctggcaggac
atcatgctggcctgcatgccaggcaagaagtgtgccccagagtccgagcccagcaacagc
acggagggtgaaacaccctgtggtagcagctttgctgtcttctacttcatcagcttctac
atgctctgtgccttcctgatcatcaacctctttgtagctgtcatcatggacaactttgac
tacctgacaagggactggtccatccttggtccccaccacctggatgagtttaaaagaatc
tgggcagagtatgaccctgaagccaagggtcgtatcaaacacctggatgtggtgaccctc
ctccggcggattcagccgccactaggttttgggaagctgtgccctcaccgcgtggcttgc
aaacgcctggtctccatgaacatgcctctgaacagcgacgggacagtcatgttcaatgcc
accctgtttgccctggtcaggacggccctgaggatcaaaacagaagggaacctagaacaa
gccaatgaggagctgcgggcgatcatcaagaagatctggaagcggaccagcatgaagctg
ctggaccaggtggtgccccctgcaggtgatgatgaggtcaccgttggcaagttctacgcc
acgttcctgatccaggagtacttccggaagttcaagaagcgcaaagagcagggccttgtg
ggcaagccctcccagaggaacgcgctgtctctgcaggctggcttgcgcacactgcatgac
atcgggcctgagatccgacgggccatctctggagatctcaccgctgaggaggagctggac
aaggccatgaaggaggctgtgtccgctgcttctgaagatgacatcttcaggagggccggt
ggcctgttcggcaaccacgtcagctactaccaaagcgacggccggagcgccttcccccag
accttcaccactcagcgcccgctgcacatcaacaaggcgggcagcagccagggcgacact
gagtcgccatcccacgagaagctggtggactccaccttcaccccgagcagctactcgtcc
accggctccaacgccaacatcaacaacgccaacaacaccgccctgggtcgcctccctcgc
cccgccggctaccccagcacggtcagcactgtggagggccacgggccccccttgtcccct
gccatccgggtgcaggaggtggcgtggaagctcagctccaacaggtgccactcccgggag
agccaggcagccatggcgggtcaggaggagacgtctcaggatgagacctatgaagtgaag
atgaaccatgacacggaggcctgcagtgagcccagcctgctctccacagagatgctctcc
taccaggatgacgaaaatcggcaactgacgctcccagaggaggacaagagggacatccgg
caatctccgaagaggggtttcctccgctctgcctcactaggtcgaagggcctccttccac
ctggaatgtctgaagcgacagaaggaccgagggggagacatctctcagaagacagtcctg
cccttgcatctggttcatcatcaggcattggcagtggcaggcctgagccccctcctccag
agaagccattcccctgcctcattccctaggccttttgccaccccaccagccacacctggc
agccgaggctggcccccacagcccgtccccaccctgcggcttgagggggtcgagtccagt
gagaaactcaacagcagcttcccatccatccactgcggctcctgggctgagaccaccccc
ggtggcgggggcagcagcgccgcccggagagtccggcccgtctccctcatggtgcccagc
caggctggggccccagggaggcagttccacggcagtgccagcagcctggtggaagcggtc
ttgatttcagaaggactggggcagtttgctcaagatcccaagttcatcgaggtcaccacc
caggagctggccgacgcctgcgacatgaccatagaggagatggagagcgcggccgacaac
atcctcagcgggggcgccccacagagccccaatggcgccctcttaccctttgtgaactgc
agggacgcggggcaggaccgagccgggggcgaagaggacgcgggctgtgtgcgcgcgcgg
ggtcgaccgagtgaggaggagctccaggacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system