KEGG   Homo sapiens (human): 7755Help
Entry
7755              CDS       T01001                                 

Gene name
ZNF205, RhitH, ZNF210, Zfp13
Definition
(RefSeq) zinc finger protein 205
  KO
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7755 (ZNF205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 554 aa AA seqDB search
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAA
CGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPD
SEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagacggcggaggcatccaggacacccaggacaaggagacacccccggaggtt
ccagatcgtggacatcctcatcaggaaatgccttctaagctgggggaggcggtaccttca
ggggacactcaggagtcactgcacattaagatggagcccgaagagccacactccgagggg
gcatcgcaggaggatggggctcaaggtgcctggggctgggcacccctaagtcacggctct
aaggagaaagctctcttcctgcctggcggagccctcccctccccccggatccccgtgctt
tcccgagaggggaggaccagagaccggcagatggctgcagcgctcctcactgcctggtcc
cagatgccagtgactttcgaggatgtggccttgtacctctcccgggaggagtggggacgg
ctggaccacacgcagcagaacttctacagggatgtcctgcagaagaaaaatgggctgtca
ctgggctttcccttcagcaggcctttctgggcccctcaagcgcacggcaagggtgaggcc
tcgggctccagccggcaggcaggagatgagaaggagtggagaggcgcgtgcacaggagcc
gtcgaggtggggcagagggtgcagacctcatccgtggcagcccttgggaatgtgaagccc
ttcagaaccagggcagggagagtccagtggggcgtcccgcagtgcgcgcaggaagcagcc
tgcggccggagctcagggccggccaaagactccgggcagccggctgagccagatcgcacc
ccggatgcagctccgccagaccccagtcccacggagccccaggagtaccgcgtcccggag
aagcccaacgaggaggagaagggcgccccggagagtggcgaggagggcctggcccctgac
agtgaggtgggcaggaagagctaccggtgcgagcagtgcggcaagggcttcagctggcac
tcgcacctggtgacgcaccggcgcacgcacacgggcgagaagccctacgcctgcactgac
tgcgggaagcgcttcggccgcagctcgcacctcatccagcaccagatcatccacacgggc
gagaagccctacacctgccccgcctgccggaagagcttcagccaccactccacgctgatt
cagcaccagcgcatccacaccggagagaagccctacgtgtgcgaccgctgcgccaagcgc
ttcacccgccgctcggacttggtcacccaccagggcacccacacgggcgccaagccgcac
aagtgccccatctgcgccaagtgcttcacgcagagctcggcgctagtcacccaccagcgc
acccacactggggtcaagccctatccgtgccccgagtgcggcaagtgcttcagccagcgt
tccaacctcatcgcgcacaaccgcacacacacaggcgagaagccctaccactgcctcgac
tgcggcaagagcttcagccacagctcgcacctcaccgcgcaccagcgcacccaccgtggc
gtgcggccctacgcctgcccgttgtgcggcaagagcttcagccggcgctccaacctgcac
cggcacgagaagatccacaccaccgggcccaaggccctggccatgctgatgctgggggcg
gcggcggcgggggctctggccacacccccacccgctcccacctag

DBGET integrated database retrieval system