KEGG   Homo sapiens (human): 777Help
Entry
777               CDS       T01001                                 

Gene name
CACNA1E, BII, CACH6, CACNL1A6, Cav2.3
Definition
calcium channel, voltage-dependent, R type, alpha 1E subunit
Orthology
K04852  
voltage-dependent calcium channel R type alpha-1E
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Type II diabetes mellitus
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.3
AA seq 2270 aa AA seqDB search
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGL
ALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDH
ELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEADTPLVLPHPELEVGKHVV
LTEQEPEGSSEQALLGNVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPL
VDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLVVTDPSSMRRSFST
IRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRER
GRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSI
PSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPLTSQALESN
NACLTESSNSPHPQQSQHASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRS
NTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 6813 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgccaggccagggtccggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctcggggcaggcggccgcctacaag
cagacgaaagcacagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tatgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcctggccctggagcagcatcttcctgaggatgacaagacccccatg
tcccgaagactggagaagacagaaccttatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcttacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcaggaacccacttc
aatactcacgtggacctgaggaccctccgggctgtgcgtgtcctgcggcctttgaagctc
gtgtcagggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtacct
cttctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggtttg
gagttctacagtggcaagttacatcgagcatgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgcaag
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccactgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccgaagggctttcatgaagctgcggcgccagcagcagattgagcgtgagctg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacatccgccttagaagtgcttcgaagggcaaccatcaagaggagccggaca
gaggccatgactcgagactccagtgatgagcactgtgttgatatctcctctgtgggcaca
cctctggcccgagccagtatcaaaagtgcaaaggtagacggggtctcttatttccggcac
aaggaaaggcttctgcgcatctccattcgccacatggttaaatcccaggtgttttactgg
attgtgctgagccttgtggcactcaacactgcctgtgtggccattgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacgtcttttggaatcagtgtcttgcgagccctccggcttctaagaatattt
aaaataaccaagtattgggcttccctacggaatttggtggtctccttgatgagctcaatg
aagtctatcatcagtttgcttttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagttatttggaggcaggtttaactttaatgatgggactccttcggcaaatttt
gataccttccctgcagccatcatgactgtgttccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtctgcc
atctacttcattgtgctcaccttgtttggcaactacacgctactgaatgtgttcttggct
atcgctgtggataatctcgccaacgcccaggaactgaccaaggatgaacaggaggaagaa
gaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtccgtgtgggagcag
cgtaccagccagctgaggaagcacatgcagatgtccagccaggaggccctcaacagagag
gaggcgccgaccatgaacccgctcaaccccctcaacccgctcagctccctcaacccgctc
aatgcccaccccagcctttatcggcgacccagggccattgagggcctggccctgggcctg
gccctggagaagttcgaggaggagcgcatcagccgtggggggtccctcaagggggatgga
ggggaccgatccagtgccctggacaaccagaggacccctttgtccctgggccagcgggag
ccaccatggctggccaggccctgtcatggaaactgtgacccgactcagcaggaggcaggg
ggaggagaggctgtggtgacctttgaggaccgggccaggcacaggcagagccaacggcgc
agccggcatcgccgcgtcaggacagaaggcaaggagtcctcttcagcctcccggagcagg
tctgccagccaggaacgcagtctggatgaagccatgcccactgaaggggagaaggaccat
gagctcaggggcaaccatggtgccaaggagccaacgatccaagaagagagagcccaggat
ttaaggaggaccaacagtctgatggtgtccagaggctccgggctggcaggaggccttgat
gaggctgacacccccctagtcctgccccatcctgagctggaagtggggaagcacgtggtg
ctgacggagcaggagccagaaggcagcagtgagcaggccctgctggggaatgtgcagcta
gacatgggccgggtcatcagccagagcgagcctgacctctcctgcatcacggccaacacg
gacaaggccaccaccgagagcaccagcgtcaccgtcgccatccccgacgtggaccccttg
gtggactcaaccgtggtgcacattagcaacaagacggatggggaagccagtcccttgaag
gaggcagagatcagagaggatgaggaggaggtggagaagaagaagcagaagaaggagaag
cgtgagacaggcaaagccatggtgccccacagctcaatgttcatcttcagcaccaccaac
ccgatccggagggcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctc
ctggtgattgcagccagcagcatcgccctggcggcagaggaccccgtcctgaccaactcg
gagcgcaacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcacctttgag
atggttataaagatgatagaccaaggcttgatcctgcaggatgggtcctacttccgagac
ttgtggaacatcctggactttgtggtggtcgttggcgcattggtggcctttgctctggcg
aacgctttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtgctc
cgagttctaaggccactgaaaaccatcaagcgcttgcccaagctcaaggccgtcttcgac
tgcgtagtgacctccttgaagaatgtcttcaacatactcattgtgtacaagctcttcatg
ttcatctttgctgtcatcgcagttcagctcttcaagggaaagttcttttattgcacggac
agttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaaaacaag
atggaggtgaagggccgggaatggaagcgccatgaattccactacgacaacattatctgg
gccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagttctgcagcac
tctgtagatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtct
atcttttatgtagtctactttgtggtcttccccttcttctttgtcaatatctttgtggct
ctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgcagcctggag
aagaatgagagggcgtgcatcgacttcgccatcagcgccaaacctctcacccgctacatg
ccgcagaacagacacaccttccagtaccgcgtgtggcactttgtggtgtctccgtccttt
gagtacaccattatggccatgatcgccttgaatactgttgtgctgatgatgaagtattat
tctgctccctgtacctatgagctggccctgaagtacctgaatatcgccttcaccatggtg
ttttccctggaatgtgtcctgaaggtcatcgcttttggctttttgaactatttccgagac
acctggaatatctttgacttcatcaccgtgattggcagtatcacagaaattatcctgaca
gacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttccgagct
gcccgcctcataaagctcctgcgtcagggctataccatacgcattttgctgtggaccttt
gtgcagtcctttaaggccctcccttatgtctgccttttaattgccatgcttttcttcatt
tatgccatcattgggatgcaggtatttggaaacataaaattagacgaggagagtcacatc
aaccggcacaacaacttccggagtttctttgggtccctaatgctactcttcaggagtgcc
acaggtgaggcctggcaggagattatgctgtcatgccttggggagaagggctgtgagcct
gacaccaccgcaccatcagggcagaacgagaacgaacgctgcggcaccgatctggcctac
gtgtactttgtctccttcatcttcttctgctccttcttgatgctcaacctgtttgtggcc
gtcatcatggacaactttgagtacctgactcgggactcctccatcctggggcctcaccac
ttggacgagtttgtccgcgtctgggcagaatatgaccgagcagcatgtggccgcatccat
tacactgagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaagaga
tgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtagctgaggac
atgacggtccacttcacctccacacttatggctctgatccggacagctctggacattaaa
attgccaaaggtggtgcagacaggcagcagctagactcagagctacaaaaggagacccta
gccatctggcctcacctatcccagaagatgctggatctgcttgtgcccatgcccaaagcc
tctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataagcag
agtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatgttccag
cgcatggagccttcatctctgcctcaggagatcattgctaatgccaaagccctgccttac
ctccagcaggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagtcca
ctctctccccaggatatattccagttggcttgtatggaccccgccgatgacggacagttc
caagaacggcagtctctggtggtgacagaccctagctccatgagacgttcattttccact
attcgggataagcgttcaaattcctcgtggttggaggaattctccatggagcgaagcagt
gaaaatacctacaagtcccgtcgccggagttaccactcctccttgcggctgtcagcccac
cgcctgaactctgattcaggccacaagtctgacactcaccgctcagggggcagggagcgg
ggacgatcaaaagagcgaaagcatcttctctctcctgatgtctcccgctgcaattcagaa
gagcgagggacccaggctgactgggagtccccagagcgccgtcaatccaggtcacccagt
gagggcaggtcacagacgcccaacagacagggcacaggttccctaagtgagagctccatc
ccctctgtctctgacaccagcaccccaagaagaagtcgtcggcagctcccacccgtcccg
ccaaagccccggcccctcctttcctacagctccctgattcgacacgcgggcagcatctct
ccacctgctgatggaagcgaggagggctccccgctgacctcccaagctctggagagcaac
aatgcttgcctgaccgagtcttccaactctccgcacccccagcagagccaacatgcctcc
ccacagcgctacatctccgagccctacttggccctgcacgaagactcccacgcctcagac
tgtggtgaggaggagacgctcactttcgaagcagccgtggctactagcctgggccgttcc
aacaccatcggctcagccccacccctgcggcatagctggcagatgcccaacgggcactat
cggcggcggaggcgcggggggcctgggccaggcatgatgtgtggggctgtcaacaacctg
ctaagtgacacggaagaagatgacaaatgctag

DBGET integrated database retrieval system