KEGG   Homo sapiens (human): 7779Help
Entry
7779              CDS       T01001                                 

Gene name
SLC30A1, ZNT1, ZRC1
Definition
solute carrier family 30 (zinc transporter), member 1
Orthology
K14688  
solute carrier family 30 (zinc transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    7779 (SLC30A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q32.3
AA seq 507 aa AA seqDB search
MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERF
ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVG
VAGLLVNVLGLCLFHHHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPG
EQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRA
GQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINS
THASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQIDIRNLIKEL
RNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPE
FASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKP
RRTKAENIPAVVIEIKNMPNKQPESSL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggggtgttggggtcggaaccggggccggctgctgtgcatgctggcgctgaccttcatg
ttcatggtgctggaggtggtggtgagccgggtgacctcgtcgctggcgatgctctccgac
tccttccacatgctgtcggacgtgctggcgctggtggtggcgctggtggccgagcgcttc
gcccggcggacccacgccacccagaagaacacgttcggctggatccgagccgaggtaatg
ggggctctggtgaacgccatcttcctgactggcctctgtttcgccatcctgctggaggcc
atcgagcgcttcatcgagccgcacgagatgcagcagccgctggtggtccttggggtcggc
gtggccgggctgctggtcaacgtgctggggctctgcctcttccaccatcacagcggcttc
agccaggactccggccacggccactcgcacgggggtcacggccacggccacggcctcccc
aaggggcctcgcgttaagagcacccgccccgggagcagcgacatcaacgtggccccgggc
gagcagggtcccgaccaggaggagaccaacaccctggtggccaataccagcaactccaac
gggctgaaattggaccccgcagacccagaaaaccccagaagtggtgatacagtggaagta
caagtgaatggaaatcttgtcagagaacctgaccatatggaactggaagaagatagggct
ggacaacttaacatgcgtggagtttttctgcatgtccttggagatgccttgggttcagtg
attgtagtagtaaatgccttagtcttttacttttcttggaaaggttgttctgaaggggat
ttttgtgtgaatccatgtttccctgacccctgcaaagcatttgtagaaataattaatagt
actcatgcatcagtttatgaggctggtccttgctgggtgctatatttagatccaactctt
tgtgttgtaatggtttgtatacttctttacacaacctatccattacttaaggaatctgct
cttattcttctacaaactgttcctaaacaaattgatatcagaaatttgataaaagaactt
cgaaatgttgaaggagttgaggaagttcatgaattacatgtttggcaacttgctggaagc
agaatcattgccactgctcacataaaatgtgaagatccaacatcatacatggaggtggct
aaaaccattaaagacgtttttcataatcacggaattcacgctactaccattcagcctgaa
tttgctagtgtaggctctaaatcaagtgtagttccgtgtgaacttgcctgcagaacccag
tgtgctttgaagcaatgttgtgggacactaccacaagccccttctggaaaggatgcagaa
aagaccccagcagttagcatttcttgtttagaacttagtaacaatctagagaagaagccc
aggaggactaaagctgaaaacatccctgctgttgtgatagagattaaaaacatgccaaac
aaacaacctgaatcatctttgtga

DBGET integrated database retrieval system