KEGG   Homo sapiens (human): 7791Help
Entry
7791              CDS       T01001                                 

Gene name
ZYX, ESP-2, HED-2
Definition
zyxin
Orthology
K06273  
zyxin
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7791 (ZYX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q32
AA seq 572 aa AA seqDB search
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
PEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARAQT
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccccgcccgtctcccgcgatctccgtttcggtctcggctccggctttttac
gccccgcagaagaagttcggccctgtggtggccccaaagcccaaagtgaatcccttccgg
cccggggacagcgagcctcccccggcacccggggcccagcgcgcacagatgggccgggtg
ggcgagattcccccgccgcccccggaagactttcccctgcctccacctccccttgctggg
gatggcgacgatgcagagggtgctctgggaggtgccttcccgccgccccctcccccgatc
gaggaatcatttccccctgcgcctctggaggaggagatcttcccttccccgccgcctcct
ccggaggaggagggagggcctgaggcccccataccgcccccaccacagcccagggagaag
gtgagcagtattgatttggagatcgactctctgtcctcactgctggatgacatgaccaag
aatgatcctttcaaagcccgggtgtcatctggatatgtgcccccaccagtggccactcca
ttcagttccaagtccagtaccaagcctgcagccgggggcacagcacccctgcctccttgg
aagtccccttccagctcccagcctctgccccaggttccggctccggctcagagccagaca
cagttccatgttcagccccagccccagcccaagcctcaggtccaactccatgtccagtcc
cagacccagcctgtgtctttggctaacacccagccccgagggcccccagcctcatctccg
gctccagcccctaagttttctccagtgactcctaagtttactcctgtggcttccaagttc
agtcctggagccccaggtggatctgggtcacaaccaaatcaaaaattggggcaccccgaa
gctctttctgctggcacaggctcccctcaacctcccagcttcacctatgcccagcagagg
gagaagccccgagtgcaggagaagcagcaccccgtgcccccaccggctcagaaccaaaac
caggtgcgctcccctggggccccagggcccctgactctgaaggaggtggaggagctggag
cagctgacccagcagctaatgcaggacatggagcatcctcagaggcagaatgtggctgtc
aacgaactctgcggccgatgccatcaacccctggcccgggcgcagccagccgtccgcgct
ctagggcagctgttccacatcgcctgcttcacctgccaccagtgtgcgcagcagctccag
ggccagcagttctacagtctggagggggcgccgtactgcgagggctgttacactgacacc
ctggagaagtgtaacacctgcggggagcccatcactgaccgcatgctgagggccacgggc
aaggcctatcacccgcactgcttcacctgtgtggtctgcgcccgccccctggagggcacc
tccttcatcgtggaccaggccaaccggccccactgtgtccccgactaccacaagcagtac
gccccgaggtgctccgtctgctctgagcccatcatgcctgagcctggccgagatgagact
gtgcgagtggtcgccctggacaagaacttccacatgaagtgttacaagtgtgaggactgc
gggaagcccctgtcgattgaggcagatgacaatggctgcttccccctggacggtcacgtg
ctctgtcggaagtgccacactgctagagcccagacctga

DBGET integrated database retrieval system