KEGG   Homo sapiens (human): 7802Help
Entry
7802              CDS       T01001                                 

Gene name
DNALI1, P28, dJ423B22.5, hp28
Definition
dynein, axonemal, light intermediate chain 1
Orthology
K10410  
dynein light intermediate chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    7802 (DNALI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35.1
AA seq 280 aa AA seqDB search
MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQP
GPSGSAPQPPKTKLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMD
VVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIR
MTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATE
KRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggcaaacaaggcccacactggacagggcagctgctgggttgctactctcgcc
tccgccatgattccgcccgcagactctttgctcaagtacgacaccccagtgctggtgagc
cggaacacggagaaacggagccccaaggctcggctactgaaagtcagcccccagcagcct
ggaccttcaggttcagccccacagccacccaagaccaagctcccctcaactccctgtgtc
ccagatcctacaaagcaggcagaagaaatcttgaatgccatactacccccaagggagtgg
gtggaagacacgcagctatggatccagcaggtgtccagcacccctagcaccaggatggac
gtggtgcacctccaggagcagttagacttaaagctgcagcagcggcaggccagggaaaca
ggcatctgccctgtccgcagggaactctactcacagtgttttgatgagttgatccgggag
gtcaccatcaactgtgcggagagggggctgctgctgctgcgagtccgggacgagatccgc
atgaccatcgctgcctaccagaccctgtacgagagcagcgtggcgtttggcatgaggaag
gcactgcaggctgagcaggggaagtcagacatggagaggaaaatcgcagaattggagacg
gaaaagagagacctggagaggcaagtgaacgagcagaaggcaaaatgtgaagccactgag
aagcgggagagcgagaggcggcaggtggaggagaagaagcacaatgaggagattcagttc
ctgaagcgaacaaatcagcagctgaaggcccaactggaaggcattattgcaccaaagaag
tga

DBGET integrated database retrieval system